Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
PTPRF Antibody (aa1167‑1203) LS‑C407998
PTPRF antibody LS-C407998 is an unconjugated rabbit polyclonal antibody to human PTPRF. Validated for IHC and WB.
100 µg

Popular PTPRF Products

Species: Human, Mouse, Rat
Applications: ICC, Western blot
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE), At a dilution of 1:100.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
Immunohistochemistry image of paraffin-embedded human small intestine tissue at a dilution of 1:100
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, IHC - Paraffin, Western blot

Product Description

PTPRF antibody LS-C407998 is an unconjugated rabbit polyclonal antibody to human PTPRF. Validated for IHC and WB.
PTPRF is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. P10586 NM_002840 NP_002831.2

PTPRF Antibody, LAR Antibody, LCA-homolog Antibody, Ptp-lar Antibody


Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
PTPRF antibody was raised against a synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)



LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.

Western blot

LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.
LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.


LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.

Western blot

LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.
LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.


LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.

Western blot

LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.
LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.


LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.
LAR antibody IHC-paraffin. IHC(P): Human Lung Cancer Tissue.

Western blot

LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.
LAR antibody Western blot. All lanes: Anti LAR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A431 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 240 kD. Observed band size: 240 kD.

Requested From: United States
Date Requested: 9/20/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy