Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334582-20 20 µl $263 
LS-C334582-50 50 µl $301 
LS-C334582-100 100 µl $359 
LS-C334582-200 200 µl $473 
PHLDA2 / TSSC3 Antibody - Immunofluorescence analysis of HeLa cell using PHLDA2 antibody. Blue: DAPI for nuclear staining.
PHLDA2 / TSSC3 Antibody - Western blot analysis of extracts of various cell lines, using PHLDA2 antibody.
PHLDA2 / TSSC3 Antibody - Immunofluorescence analysis of HeLa cell using PHLDA2 antibody. Blue: DAPI for nuclear staining.
PHLDA2 / TSSC3 Antibody - Western blot analysis of extracts of various cell lines, using PHLDA2 antibody.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human PHLDA2 / TSSC3 Antibody (IHC, IF, WB) LS‑C334582

Polyclonal Rabbit anti‑Human PHLDA2 / TSSC3 Antibody (IHC, IF, WB) LS‑C334582

Antibody:
PHLDA2 / TSSC3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334582-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
PHLDA2 / TSSC3 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TSSC3 antibody LS-C334582 is an unconjugated rabbit polyclonal antibody to human TSSC3 (PHLDA2). Validated for IF, IHC and WB.
Target
Human PHLDA2 / TSSC3
Synonyms
PHLDA2 | BWR1C | IPL | HLDA2 | p17-BWR1C | BRW1C | TSSC3 | Tumor-supressing STF cDNA 3
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human PHLDA2 (NP_003302.1). MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Specificity
Human PHLDA2 / TSSC3
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:20 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 17kDa, while the observed MW by Western blot was 20kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PHLDA2 / TSSC3
Q53GA4 NM_003311 NP_003302.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022