Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

NPFF2 / NPFFR2 Antibody LS‑C497373

Catalog Number Size Price
LS-C497373-50 50 µl $235 
LS-C497373-100 100 µl $295 
LS-C497373-200 200 µl $385 
Western blot analysis of extracts of various cell lines, using NPFFR2 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

NPFF2 / NPFFR2 Antibody LS‑C497373

Antibody:
Rabbit Polyclonal to Human NPFF2 / NPFFR2
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C497373-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human NPFF2 / NPFFR2
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
NPFFR2 antibody LS-C497373 is an unconjugated rabbit polyclonal antibody to NPFFR2 (NPFF2 ) from mouse and rat. Validated for WB.
Target
Human NPFF2 / NPFFR2
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Applications
  • Western blot
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human NPFFR2 (NP_004876.2). MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYY
Usage
The predicted MW is 15kDa/48kDa/49kDa/60kDa, while the observed MW by Western blot was 48kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About NPFF2 / NPFFR2
Q9Y5X5 NM_004885 NP_004876.2

Publications (0)

Reviews (0)

Featured Products

Anti-NPFF2 / NPFFR2 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Horse
Applications: IHC, IHC - Paraffin
Anti-NPFF2 / NPFFR2 antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 4-7 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin
Anti-NPFFR2 antibody IHC of human brain, neurons and glia. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin
Anti-NPFFR2 antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin
NPFFR2 Antibody western blot of NCI-H460 cell line lysates (35 ug/lane). The NPFFR2 antibody detected the NPFFR2 protein (arrow).
Species: Human
Applications: Western blot
Reactivity: Human
Range: 1-200 ng/ml

Requested From: United States
Date Requested: 9/16/2019