Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > LYN > LS-C662096
 
Print Page  
Catalog Number Size Price
LS-C662096-10 10 µg $318 
LS-C662096-100 100 µg $470 
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of mouse intestine tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of rat spleen tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of mouse spleen tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of rat lymphaden tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - Western blot analysis of Lyn using anti-Lyn antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human 293T whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Lyn antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Lyn at approximately 59KD. The expected band size for Lyn is at 59KD.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of mouse intestine tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of rat spleen tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of mouse spleen tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - IHC analysis of Lyn using anti-Lyn antibody. Lyn was detected in paraffin-embedded section of rat lymphaden tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-Lyn Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
LYN Antibody - Western blot analysis of Lyn using anti-Lyn antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human 293T whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Lyn antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Lyn at approximately 59KD. The expected band size for Lyn is at 59KD.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human LYN Antibody (IHC, WB) LS‑C662096

Polyclonal Rabbit anti‑Human LYN Antibody (IHC, WB) LS‑C662096

Submit Review LSBio Guarantee
Antibody:
LYN Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662096-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
LYN Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
LYN antibody LS-C662096 is an unconjugated rabbit polyclonal antibody to human LYN. Validated for IHC and WB.
Target
Human LYN
Synonyms
LYN | Lyn protein tyrosine kinase | Lyn ptk | Lyn tyrosine kinase | p56Lyn | p53Lyn | Tyrosine-protein kinase Lyn | JTK8 | Lyn kinase
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human Lyn (470-501 aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Specificity
Detected in monocytes (at protein level). Detected in placenta, and in fetal brain, lung, liver and kidney. Widely expressed in a variety of organs, tissues, and cell types such as epidermoid, hematopoietic, and neuronal cells. Expressed in primary neuroblastoma tumors. .
Applications
  • IHC
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About LYN
P07948 NM_002350 NP_002341.1

Publications (0)

Submit a Publication for LS-C662096

Customer Reviews (0)

Submit a review for LS-C662096

Featured Products

LYN Antibody - Anti-LYN antibody IHC of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
IHC‑plus™ LYN Antibody (aa39‑58) LS‑B7849
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation
LYN Antibody - Immunohistochemical of paraffin-embedded M.spleen section using Mouse Lyn Antibody. NA was diluted at 1:25 dilution. A peroxidase-conjugated goat anti-rabbit IgG at 1:400 dilution was used as the secondary antibody, followed by DAB staining.
LYN Antibody (aa229‑263) LS‑C344391
Species: Human, Rat
Applications: IHC, IHC - Paraffin, Western blot
LYN Antibody - Immunohistochemical analysis of LYN staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected with HRP and DAB as chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
LYN Antibody (C‑Terminus) LS‑C368649
Species: Human, Mouse, Rat, Bovine, Sheep, Chicken
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation
LYN Antibody - Western blot of Phospho-Lyn (Y508) antibody
LYN Antibody (phospho‑Tyr508) LS‑C381202
Species: Human, Mouse, Rat
Applications: IHC, Western blot, ELISA
LYN Antibody - 1:200 staining rat liver tissue by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22°C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.
LYN Antibody (phospho‑Tyr508) LS‑C800979
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
LYN Antibody - Immunohistochemistry analysis of paraffin-embedded human brain, using Lyn (Phospho-Tyr507) Antibody. The picture on the right is blocked with the phospho peptide.
LYN Antibody (phospho‑Tyr507) LS‑C199208
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
See all LYN Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/28/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com