Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C750042-20 20 µl $253 
LS-C750042-50 50 µl $279 
LS-C750042-100 100 µl $333 
LS-C750042-200 200 µl $429 
LTC4S / LTC4 Synthase Antibody - Western blot analysis of extracts of A-549 cells, using LTC4S antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Polyclonal Rabbit anti‑Human LTC4S / LTC4 Synthase Antibody (WB) LS‑C750042

Polyclonal Rabbit anti‑Human LTC4S / LTC4 Synthase Antibody (WB) LS‑C750042

Antibody:
LTC4S / LTC4 Synthase Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C750042-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
LTC4S / LTC4 Synthase Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
LTC4 Synthase antibody LS-C750042 is an unconjugated rabbit polyclonal antibody to human LTC4 Synthase (LTC4S). Validated for WB.
Target
Human LTC4S / LTC4 Synthase
Synonyms
LTC4S | Leukotriene C4 synthase | Leukotriene-C(4) synthase | LTC4 synthase
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human LTC4S (NP_665874.1). YRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 16kDa, while the observed MW by Western blot was 17kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About LTC4S / LTC4 Synthase
Q16873 A98607 AAA20467.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/11/2021