Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334475-20 20 µl $263 
LS-C334475-50 50 µl $301 
LS-C334475-100 100 µl $359 
LS-C334475-200 200 µl $473 
LIN28A / LIN28 Antibody - Western blot analysis of extracts of various cell lines.

Polyclonal Rabbit anti‑Human LIN28A / LIN28 Antibody (WB) LS‑C334475

Polyclonal Rabbit anti‑Human LIN28A / LIN28 Antibody (WB) LS‑C334475

Antibody:
LIN28A / LIN28 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334475-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
LIN28A / LIN28 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
LIN28 antibody LS-C334475 is an unconjugated rabbit polyclonal antibody to LIN28 (LIN28A) from human. It is reactive with human and mouse. Validated for WB.
Target
Human LIN28A / LIN28
Synonyms
LIN28A | CSDD1 | Lin-28 homolog (C. elegans) | LIN-28 | Lin-28A | LIN28 | Protein lin-28 homolog A | Lin-28 homolog A (C. elegans) | ZCCHC1 | RNA-binding protein LIN-28
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 142-209 of human LIN28 (NP_078950.1). CGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Specificity
Human LIN28A / LIN28
Applications
  • Western blot (1:500 - 1:1000)
Usage
The predicted MW is 22kDa, while the observed MW by Western blot was 28kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About LIN28A / LIN28
Q9H9Z2 NM_024674 NP_078950.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/8/2022