LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

ITGB3 / Integrin Beta 3 / CD61 Antibody LS-C332152

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of mouse spleen cells.
Western blot analysis of extracts of various cells.
Western blot analysis of extracts of mouse spleen cells.
1 of 2
2 of 2

ITGB3 / Integrin Beta 3 / CD61 Antibody LS-C332152

Antibody:
Rabbit Polyclonal to Human ITGB3 / Integrin Beta 3 / CD61
Application:
IHC, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C332152-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human ITGB3 / Integrin Beta 3 / CD61
Application:
IHC, WB
Reactivity:
Human, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CD61 antibody LS-C332152 is an unconjugated rabbit polyclonal antibody to CD61 (ITGB3 / Integrin Beta 3) from human and rat. Validated for IHC and WB.

Target
Human ITGB3 / Integrin Beta 3 / CD61
Host
Rabbit
Reactivity
Human, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 610-718 of human ITGB3 (NP_000203.2). GSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD
Specificity
Human ITGB3 / Integrin Beta 3 / CD61
Usage
The predicted MW is 86kDa/87kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ITGB3 / Integrin Beta 3 / CD61
P05106 NM_000212 NP_000203.2

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 31.25-2000 pg/ml
Reactivity: Human
Range: 15.63-1000 pg/ml
Western blot analysis of lysates from A431 cells, using phospho-CD167a (Phospho-Tyr792) antibody.
Species: Human, Mouse, Rat
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Reactivity: Human, Mouse, Rat
Range: Positive/Negative

Requested From: United States
Date Requested: 6/25/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy