Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13381-50 50 µl $460 
PKG / PRKG1 Antibody - Human Uterus, Myometrium: Formalin-Fixed, Paraffin-Embedded (FFPE)
PKG / PRKG1 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
PKG / PRKG1 Antibody - Western blot analysis of extracts of various cell lines, using PRKG1 antibody.
PKG / PRKG1 Antibody - Human Uterus, Myometrium: Formalin-Fixed, Paraffin-Embedded (FFPE)
PKG / PRKG1 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
PKG / PRKG1 Antibody - Western blot analysis of extracts of various cell lines, using PRKG1 antibody.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human PKG / PRKG1 Antibody (IHC, WB) LS‑B13381

IHC‑plus™ Polyclonal Rabbit anti‑Human PKG / PRKG1 Antibody (IHC, WB) LS‑B13381

Note: This antibody replaces LS-C332170
Antibody:
PKG / PRKG1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13381-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
PKG / PRKG1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
PRKG1 antibody LS-B13381 is an unconjugated rabbit polyclonal antibody to PRKG1 (PKG) from human. It is reactive with human and mouse. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human PKG / PRKG1
Synonyms
PRKG1 | CGKI | CGMP kinase I | CGMP protein kinase type I | CGK-I | CGK1 | PKGI | PKG I | PRKGR1B | PRKG1B | PRKGR1A | PGK | PKG | CGK | CGK 1 | CGKI-alpha | CGKI-BETA
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PRKG1 (NP_006249.1). MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
Specificity
Human PKG / PRKG1
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 44kDa/76kDa/77kDa, while the observed MW by Western blot was 65kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About PKG / PRKG1
Q13976 NM_006258 NP_006249.1

Validation

PKG / PRKG1 Antibody - Human Uterus, Myometrium: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Uterus, Myometrium: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Uterus, Myometrium: Formalin-Fixed, Paraffin-Embedded (FFPE)

PKG / PRKG1 Antibody - Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ PKG / PRKG1 Antibody for IHC, WB/Western LS-B13381 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2021