Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B13380-50 50 µl $460 
FCGR3A / CD16A Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
FCGR3A / CD16A Antibody - Western blot analysis of extracts of mouse liver, using FCGR3A antibody.
FCGR3A / CD16A Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
FCGR3A / CD16A Antibody - Western blot analysis of extracts of mouse liver, using FCGR3A antibody.
1 of 2
2 of 2

IHC‑plus™ Polyclonal Rabbit anti‑Human FCGR3A / CD16A Antibody (IHC, WB) LS‑B13380

IHC‑plus™ Polyclonal Rabbit anti‑Human FCGR3A / CD16A Antibody (IHC, WB) LS‑B13380

Note: This antibody replaces LS-C332158
Antibody:
FCGR3A / CD16A Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B13380-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
FCGR3A / CD16A Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CD16A antibody LS-B13380 is an unconjugated rabbit polyclonal antibody to CD16A (FCGR3A) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human FCGR3A / CD16A
Synonyms
FCGR3A | CD16A | CD16a antigen | CD16 | FcgammaRIIIA | FCR-10 | FCRIII | Fc gamma receptor III-A | Fc-gamma RIII | Fc-gamma RIII-alpha | FCG3 | IGFR3 | Fc- gamma riii | Fc-gamma receptor IIIb (CD16) | Fc-gamma RIIIa | FCGR3 | FCRIIIA | Neutrophil-specific antigen NA | Igg fc receptor iii-1 | IgG Fc receptor III-2 | Igg fc receptors iii-1 | FCGRIII
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human FCGR3A (NP_001121067.1). YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
Specificity
Human FCGR3A / CD16A
Applications
  • IHC (1:50 - 1:200)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 29kDa, while the observed MW by Western blot was 27kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FCGR3A / CD16A
P08637 NM_000569 NP_000560.5

Validation

FCGR3A / CD16A Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

IHC-plus™ FCGR3A / CD16A Antibody for IHC, WB/Western LS-B13380 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/19/2024