Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B15336-50 50 µl (0.82 mg/ml) $460 
ARG1 / Arginase 1 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
ARG1 / Arginase 1 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
ARG1 / Arginase 1 Antibody - Western blot analysis of extracts of various cell lines.
ARG1 / Arginase 1 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
ARG1 / Arginase 1 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
ARG1 / Arginase 1 Antibody - Western blot analysis of extracts of various cell lines.
1 of 3
2 of 3
3 of 3

IHC‑plus™ Polyclonal Rabbit anti‑Human ARG1 / Arginase 1 Antibody (IHC, WB) LS‑B15336

IHC‑plus™ Polyclonal Rabbit anti‑Human ARG1 / Arginase 1 Antibody (IHC, WB) LS‑B15336

Note: This antibody replaces LS-C331730
Antibody:
ARG1 / Arginase 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B15336-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ARG1 / Arginase 1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
Arginase 1 antibody LS-B15336 is an unconjugated rabbit polyclonal antibody to Arginase 1 (ARG1) from human. It is reactive with mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human ARG1 / Arginase 1
Synonyms
ARG1 | Arginase, liver | Arginase 1 | Liver-type arginase | Liver arginase | Arginase-1 | Type I arginase
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human ARG1 (NP_000036.2). MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Specificity
Human ARG1 / Arginase 1
Applications
  • IHC
  • IHC - Paraffin (1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 25kDa/34kDa/35kDa, while the observed MW by Western blot was 36kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ARG1 / Arginase 1
P05089 NM_000045 NP_000036.2

Validation

ARG1 / Arginase 1 Antibody - Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
Human Uterus: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.

ARG1 / Arginase 1 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.

LSBio Ratings

IHC-plus™ ARG1 / Arginase 1 Antibody for IHC, WB/Western LS-B15336 has an LSBio Rating of
Laboratory Validation Score (4)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/24/2024