Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B7901-100 100 µl $425 
AIFM1 / AIF / PDCD8 Antibody - Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 ug/ml.

IHCPlus™ AIFM1 / AIF / PDCD8 Antibody Polyclonal IHC,WB LS‑B7901

IHCPlus™ AIFM1 / AIF / PDCD8 Antibody Polyclonal IHC,WB LS‑B7901

Note: This antibody replaces LS-C150713
Antibody:
Rabbit Polyclonal to Human AIFM1 / AIF / PDCD8
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B7901-100
100 µl
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human AIFM1 / AIF / PDCD8
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
PDCD8 antibody LS-B7901 is an unconjugated rabbit polyclonal antibody to PDCD8 (AIFM1 / AIF ) from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human AIFM1 / AIF / PDCD8
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (5 µg/ml)
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA
Blocking Peptide
LS-E47577 - Lyophilized - 1 ea - $145.00
Immunizing peptide used to generate LS-B7901. Useful for pre-absorption and neutralization of the antibody's antigen binding site.
Presentation
TBS, 0.5 mg/ml BSA, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: store at 4°C. Long term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About AIFM1 / AIF / PDCD8
O95831 NM_004208 NP_004199.1

Validation

AIFM1 / AIF / PDCD8 Antibody - Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 ug/ml.
Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 ug/ml.
Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 ug/ml.

Publications (0)

Customer Reviews (0)


Requested From: United States
Date Requested: 11/18/2019