Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C332153-20 20 µl $263 
LS-C332153-50 50 µl $301 
LS-C332153-100 100 µl $359 
LS-C332153-200 200 µl $473 
ESR2 / ER Beta Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
ESR2 / ER Beta Antibody - Western blot analysis of extracts of various cell lines, using ESR2 antibody.
ESR2 / ER Beta Antibody - Immunohistochemistry of paraffin-embedded mouse lung tissue.
ESR2 / ER Beta Antibody - Western blot analysis of extracts of various cell lines, using ESR2 antibody.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human ESR2 / ER Beta Antibody (IHC, WB) LS‑C332153

Polyclonal Rabbit anti‑Human ESR2 / ER Beta Antibody (IHC, WB) LS‑C332153

Antibody:
ESR2 / ER Beta Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C332153-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ESR2 / ER Beta Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
ER Beta antibody LS-C332153 is an unconjugated rabbit polyclonal antibody to ER Beta (ESR2) from human. It is reactive with human and mouse. Validated for IHC and WB.
Target
Human ESR2 / ER Beta
Synonyms
ESR2 | ESTRB | ER Beta | ERbeta | ER-BETA | ESR-BETA | ESRB | Estrogen receptor 2 (ER beta) | NR3A2 | Estrogen receptor beta | Estrogen receptor beta 4
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESR2 (NP_001201832.1). MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHV
Specificity
Human ESR2 / ER Beta
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 35-59kDa, while the observed MW by Western blot was 66kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ESR2 / ER Beta
Q92731 NM_001437 NP_001428.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/6/2022