Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C827845-0.1 0.1 mg (1 mg/ml) $482 
DSG2 / Desmoglein 2 Antibody

Monoclonal Mouse anti‑Human DSG2 / Desmoglein 2 Antibody (clone 10D2, IF, WB) LS‑C827845

Monoclonal Mouse anti‑Human DSG2 / Desmoglein 2 Antibody (clone 10D2, IF, WB) LS‑C827845

Antibody:
DSG2 / Desmoglein 2 Mouse anti-Human Monoclonal (10D2) Antibody
Application:
ICC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$482
LS-C827845-0.1
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
DSG2 / Desmoglein 2 Mouse anti-Human Monoclonal (10D2) Antibody
Application:
ICC, IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Desmoglein 2 antibody LS-C827845 is an unconjugated mouse monoclonal antibody to human Desmoglein 2 (DSG2). Validated for ICC, IF, IP and WB.
Target
Human DSG2 / Desmoglein 2
Synonyms
DSG2 | ARVC10 | Cadherin family member 5 | CDHF5 | CMD1BB | Desmoglein-2 | Desmoglein II | HDGC | ARVD10 | Desmoglein 2
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Predicted
Mouse (at least 90% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Clone
10D2
Conjugations
Unconjugated
Purification
Protein A affinity chromatography
Modifications
Unmodified
Immunogen
N terminal amino acids 37-164 of Human Desmoglein 2 fused to a proprietary tag, Swiss ID = Q14126 LLPKHPHLVRQKRAWITAPVALREGEDLSKKNPIAKIHSD LAEERGLKITYKYTGKGITE PPFGIFVFNKDTGELNVTS ILDREETPFFLLTGYALDARGNNVEKPLELRIKVLDINDN E PVFTQDVF
Specificity
Specifically recognizes the EC1 region of desmoglein-2
Applications
  • ICC
  • Immunofluorescence
  • Western blot (1:100)
  • Immunoprecipitation
Usage
Optimal antibody dilution should be determined by titration. However as a guideline try; WB: 1:100. Detects a band of approximately 160 kDa. Predicted molecular weight: 122 kDa.
Presentation
PBS, 0.1% Sodium Azide
Storage
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About DSG2 / Desmoglein 2
Q14126 NM_001943 NP_001934.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/1/2024