Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C334550-20 20 µl $263 
LS-C334550-50 50 µl $301 
LS-C334550-100 100 µl $359 
LS-C334550-200 200 µl $473 
DLG4 / PSD95 Antibody - Western blot analysis of extracts of Mouse brain, using DLG4 antibody.

Polyclonal Rabbit anti‑Human DLG4 / PSD95 Antibody (IHC, WB) LS‑C334550

Polyclonal Rabbit anti‑Human DLG4 / PSD95 Antibody (IHC, WB) LS‑C334550

DLG4 / PSD95 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


DLG4 / PSD95 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


PSD95 antibody LS-C334550 is an unconjugated rabbit polyclonal antibody to PSD95 (DLG4) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
Human DLG4 / PSD95
DLG4 | Disks large homolog 4 | Presynaptic density protein 95 | PSD95 | SAP-90 | Synapse-associated protein 90 | PSD-95 | SAP90 | Tax interaction protein 15 | Discs large homolog 4
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DLG4 (NP_001356.1). MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGT
Human DLG4 / PSD95
  • IHC (1:50 - 1:100)
  • Western blot (1:500 - 1:1000)
  • Immunoprecipitation (1:20 - 1:50)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 80kDa/85kDa, while the observed MW by Western blot was 90kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About DLG4 / PSD95
P78352 NM_001365 NP_001356.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 12/9/2022