Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CLPS / Colipase Antibody LS-C747849

Colipase antibody LS-C747849 is an unconjugated rabbit polyclonal antibody to Colipase (CLPS) from human, mouse and rat. Validated for WB.
50 µl
100 µl
200 µl
Colipase antibody LS-C747849 is an unconjugated rabbit polyclonal antibody to Colipase (CLPS) from human, mouse and rat. Validated for WB.
Human CLPS / Colipase
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
CLPS / Colipase antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human CLPS (NP_001823.1). ALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CLPS / Colipase
P04118 NM_001832 NP_001823.1

Popular CLPS / Colipase Products

Species: Pig
Applications: Western blot
Immunofluorescence analysis of HeLa cells.
Species: Human, Mouse
Applications: IHC, Immunofluorescence, Western blot
Immunofluorescent analysis of Colipase staining in HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with the primary antibody in 3% BSA-PBS and incubated overnight at 4 deg C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight 594-conjugated secondary antibody (red) in PBS at room temperature in the dark.
Species: Human, Mouse
Applications: ICC, Immunofluorescence, Western blot
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Species: Human
Applications: IHC, IHC - Paraffin, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Western blot

Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Western blot

Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Western blot

Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using CLPS antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Requested From: United States
Date Requested: 5/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy