LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CDK6 Antibody LS‑C331529
CDK6 antibody LS-C331529 is an unconjugated rabbit polyclonal antibody to CDK6 from human, mouse and rat. Validated for IF, IHC, IP and WB.
Catalog
Size
Price
LS-C331529-50
50 µl
$235
LS-C331529-100
100 µl
$315
LS-C331529-200
200 µl
$425
Description
CDK6 antibody LS-C331529 is an unconjugated rabbit polyclonal antibody to CDK6 from human, mouse and rat. Validated for IF, IHC, IP and WB.
Target
Human CDK6
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CDK6 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human CDK6 (NP_001250.1). MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Specificity
Human Cdk6
Usage
The predicted MW is 36kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About CDK6
Q00534 NM_001259 NP_001250.1

Popular CDK6 Products

Antibody
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation
Anti-CDK6 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, Immunoprecipitation
Antibody
Species: Human
Applications: IHC, Western blot, Immunoprecipitation
Immunohistochemistry of paraffin-embedded human colon carcinoma tissue using CDK6 (aa11-15) antibody (left) or the same antibody preincubated with blocking peptide (right).
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).

Requested From: United States
Date Requested: 12/16/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy