LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
BMP5 Antibody IHC‑plus™ LS‑B14920
Note: This antibody replaces LS-C409936
BMP5 antibody LS-B14920 is an unconjugated rabbit polyclonal antibody to BMP5 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B14920-50
50 µl
$425
Description
BMP5 antibody LS-B14920 is an unconjugated rabbit polyclonal antibody to BMP5 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human BMP5
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
BMP5 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1). AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Specificity
Human BMP5
Usage
The predicted MW is 47kDa/51kDa, while the observed MW by Western blot was 52kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About BMP5
P22003 NM_021073 NP_066551.1

Popular BMP5 Products

Anti-BMP5 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Antibody
Species: Human
Applications: Western blot
BMP5 antibody IHC-paraffin. IHC(P): Rat Lung Tissue.
Species: Human, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Immunohistochemistry - Paraffin Image
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Rat, Pig, Chicken
Applications: IHC, IHC - Paraffin, Western blot

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

: Formalin-Fixed, Paraffin-Embedded (FFPE)
: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cells, using BMP5 antibody.
Western blot blot of extracts of various cells, using BMP5 antibody.

Immunohistochemistry - Paraffin

: Formalin-Fixed, Paraffin-Embedded (FFPE)
: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cells, using BMP5 antibody.
Western blot blot of extracts of various cells, using BMP5 antibody.

Immunohistochemistry - Paraffin

: Formalin-Fixed, Paraffin-Embedded (FFPE)
: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cells, using BMP5 antibody.
Western blot blot of extracts of various cells, using BMP5 antibody.

Immunohistochemistry - Paraffin

: Formalin-Fixed, Paraffin-Embedded (FFPE)
: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot blot of extracts of various cells, using BMP5 antibody.
Western blot blot of extracts of various cells, using BMP5 antibody.

Requested From: United States
Date Requested: 12/19/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy