LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

BMP5 Antibody IHC-plus™ LS-B14920

Note: This antibody replaces LS-C409936
: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot blot of extracts of various cells, using BMP5 antibody.
: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot blot of extracts of various cells, using BMP5 antibody.
1 of 2
2 of 2

BMP5 Antibody IHC-plus™ LS-B14920

Note: This antibody replaces LS-C409936
Antibody:
Rabbit Polyclonal to Human BMP5
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B14920-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human BMP5
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
BMP5 antibody LS-B14920 is an unconjugated rabbit polyclonal antibody to BMP5 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

Target
Human BMP5
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • IHC - Paraffin (1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
BMP5 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 317-454 of human BMP5 (NP_066551.1). AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Specificity
Human BMP5
Usage
The predicted MW is 47kDa/51kDa, while the observed MW by Western blot was 52kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About BMP5
P22003 NM_021073 NP_066551.1

Validation

: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
: Formalin-Fixed, Paraffin-Embedded (FFPE)
: Formalin-Fixed, Paraffin-Embedded (FFPE)

Publications (0)

Reviews (0)

Featured Products

Anti-p16INK4A antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Reactivity: Mouse
Range: 62.5-4000 pg/ml
Anti-MSLN / Mesothelin antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 15 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Anti-SIGLEC15 / SIGLEC-15 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Requested From: United States
Date Requested: 7/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy