Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407898-100 100 µg $355 
B3GNT8 Antibody - B3GNT8 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
B3GNT8 Antibody - B3GNT8 antibody Western blot. All lanes: Anti B3GNT8 at 0.5 ug/ml. WB: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
B3GNT8 Antibody - B3GNT8 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
B3GNT8 Antibody - B3GNT8 antibody Western blot. All lanes: Anti B3GNT8 at 0.5 ug/ml. WB: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.
1 of 2
2 of 2

B3GNT8 Antibody (aa360‑397) LS‑C407898

B3GNT8 Antibody (aa360‑397) LS‑C407898

Antibody:
Rabbit Polyclonal to Human B3GNT8
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$355 
LS-C407898-100
100 µg
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human B3GNT8
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
B3GNT8 antibody LS-C407898 is an unconjugated rabbit polyclonal antibody to human B3GNT8. Validated for IHC and WB.
Target
Human B3GNT8
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397 aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids.
Epitope
aa360-397
Specificity
Highly expressed in small intestine, pancreas, spleen, bone marrow, lung, throat, and ileum, and weakly in fetal brain, cerebellum, heart, liver, tongue, breast, uteri, and testis. Not detected in colon. Differentially expressed in human tumor cell lines. .
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute in 200 ul distilled water
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About B3GNT8

Publications (0)

Reviews (0)

Featured Products


Requested From: United States
Date Requested: 10/19/2019