Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C490358-100 100 µg $435 
B3GNT8 Antibody
B3GNT8 Antibody
B3GNT8 Antibody
B3GNT8 Antibody
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human B3GNT8 Antibody (IHC, WB) LS‑C490358

Polyclonal Rabbit anti‑Human B3GNT8 Antibody (IHC, WB) LS‑C490358

B3GNT8 Rabbit anti-Human Polyclonal Antibody
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


B3GNT8 Rabbit anti-Human Polyclonal Antibody
Unconjugated, Unmodified


B3GNT8 antibody LS-C490358 is an unconjugated rabbit polyclonal antibody to human B3GNT8. Validated for IHC and WB.
Human B3GNT8
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitute in sterile distilled water.
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About B3GNT8

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 9/21/2020