LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
APOE / Apolipoprotein E Antibody (AP) LS‑C408190
Apolipoprotein E antibody LS-C408190 is an AP-conjugated rabbit polyclonal antibody to Apolipoprotein E (APOE) from human and mouse. Validated for IF and IHC.
Catalog
Size
Price
LS-C408190-50
50 µl
$255
LS-C408190-100
100 µl
$315
LS-C408190-200
200 µl
$425
Description
Apolipoprotein E antibody LS-C408190 is an AP-conjugated rabbit polyclonal antibody to Apolipoprotein E (APOE) from human and mouse. Validated for IF and IHC.
Target
Human APOE / Apolipoprotein E
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Alkaline Phosphatase
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:100)
  • Immunofluorescence
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human APOE (NP_000032.1). GPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEK
Specificity
Human APOE / Apolipoprotein E
Usage
The predicted MW is 36kDa, while the observed MW by Western blot was Refer to Figures.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About APOE / Apolipoprotein E
P02649 NM_000041 NP_000032.1

Popular APOE / Apolipoprotein E Products

Anti-APOE / Apolipoprotein E antibody IHC of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, ELISA
Immunohistochemistry Image
Species: Human
Applications: IHC, Western blot, Immunoprecipitation
Anti-APOE / Apolipoprotein E antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).

Immunofluorescence

Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).

Immunofluorescence

Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).

Immunofluorescence

Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse lung using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human stomach using ApoE antibodyat dilution of 1:100 (40x lens).

Immunohistochemistry

Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).
Immunohistochemistry of formalin-fixed paraffin-embedded (FFPE) human prostate using ApoE antibody at dilution of 1:100 (40x magnification).

Immunofluorescence

Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of A431 cells using ApoE antibodyat dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Requested From: United States
Date Requested: 12/13/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy