LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All ELISA Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-NPPA / ANP Antibody (aa1-30) LS-C126932


Wt. Vol. Conc. Price
- 20 µl - $345
- 100 µl - $740
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular NPPA / ANP Antibodies

Anti-NPPA / ANP Antibody (aa95-101) LS-C124755
Sheep Polyclonal to Human NPPA / ANP
Anti-NPPA / ANP Antibody (aa137-150) IHC-plus™ LS-B9548
Goat Polyclonal to Human NPPA / ANP
Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Horse, Rabbit, Sheep
IHC - Paraffin, Western blot, ELISA
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Sheep Polyclonal to Human NPPA / ANP
ELISA, Radioimmunoassay


Human NPPA / ANP
Human (tested or 100% immunogen sequence identity)
Monkey, Guinea pig, Hamster (at least 90% immunogen sequence identity)


  • Radioimmunoassay (1:5000)

Specificity and Use

NPPA / ANP antibody was raised against synthetic human pro-ANP (aa 1-30) polylysine conjugated(NPMYNAVSNADLMDFKNLLDHLEEKMPLED). Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Guinea pig (93%); Hamster (90%); Mouse, Rat, Dolphin, Panda, Cat, Pig (87%); Sheep, Elephant, Bovine, Rabbit (83%); Dog, Horse (80%).
Recognizes synthetic human pro-Atrial Natriuretic Peptide (aa 1-30). There were no cross reactivities obtained with human pro-ANP.
Suitable for use in ELISA, RIA. RIA: 1:5000.


20 µl or 100 µl Sterile distilled water
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C.
For research use only.

About NPPA / ANP

P01160 NM_006172 NP_006163.1

NPPA Antibody, ANF Antibody, ANP Antibody, Atriopeptin Antibody, ATFB6 Antibody, Atrial natriuretic factor Antibody, CDD-ANF Antibody, Cardionatrin Antibody, Natriuretic peptides A Antibody, Prepronatriodilatin Antibody, Natriuretic peptide A Antibody, PND Antibody

Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.

Requested From: United States
Date Requested: 2/23/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number