  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Anti-IL21 Receptor Antibody (aa35-64) LS-C83977

Note: This antibody replaces LS-C8220, LS-C8219, LS-C70990
Catalog Size Price
LS-C83977-200 200 µg (1 mg/ml) Unavailable

Related Products

39 IL21 Receptor Antibodies

Most Popular IL21 Receptor Antibodies

Anti-IL21 Receptor Antibody (aa65-80) LS-C723
Rabbit Polyclonal (IgG) to Human IL21 Receptor
Human, Monkey
Western blot, ELISA
Western blot Image
Anti-IL21 Receptor Antibody (aa97-111) IHC-plus™ LS-B572
Rabbit Polyclonal to Human IL21 Receptor
Human, Mouse, Rat
IHC - Paraffin, Western blot
Immunohistochemistry Image
Anti-IL21 Receptor Antibody (aa35-64) LS-C83978
Goat Polyclonal to Human IL21 Receptor
Anti-IL21 Receptor Antibody (clone 4A9, PE) LS-C106102
Rat Monoclonal [clone 4A9] (IgG2a,k) to Mouse IL21 Receptor
Flow Cytometry
PE Conjugated
Flow Cytometry Image
Anti-IL21 Receptor Antibody (clone 4A9, Biotin) LS-C106420
Rat Monoclonal [clone 4A9] (IgG2a,k) to Mouse IL21 Receptor
Flow Cytometry
Biotin Conjugated
Flow Cytometry Image

100% Guaranteed
Rabbit Polyclonal to Mouse IL21 Receptor
IHC, Flow Cytometry, ELISA


Mouse IL21 Receptor
Mouse (tested or 100% immunogen sequence identity)
Rat (at least 90% immunogen sequence identity)
Immunoaffinity purified


  • IHC
  • Flow Cytometry
  • ELISA (1:100000)

Specificity and Use

IL21 Receptor antibody was raised against synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%).
Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.


10 mM KHPO4, 140 mM NaCl with 0.1% sodium azide
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
For research use only.

About IL21 Receptor

Q9HBE5 NM_021798 NP_068570.1

IL21R Antibody, CD360 Antibody, Interleukin 21 receptor Antibody, Interleukin-21 receptor Antibody, NILR Antibody, IL-21 receptor Antibody, CD360 antigen Antibody, IL-21R Antibody, IL21 Receptor Antibody, Novel interleukin receptor Antibody

IL21 Receptor is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells.

Requested From: 
Date Requested: 6/26/2017

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2017 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number