LSBio The Immunohistochemistry Antibody Company
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA Kits
  • All Kits
  • Sandwich ELISA Kits
  • Competitive EIA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Direct ELISA Kits
  • Functional ELISA Kits
  • Phospho-Specific ELISA Kits
  • Custom ELISA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Immunohistochemistry
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Other
  • Blocking Peptides
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Our Rewards Program
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Publications
  • Secure Logins
  • Login to Our Secure FTP Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Quick Order ▾
View Cart

Anti-FSH Receptor / FSHR Antibody (aa626-659) LS-C123579

Wt. Vol. Conc. Price
100 µg - 0.2 mg/ml $530
Inquire for larger quantities

LSBio (Direct) LSBio (Direct)

Most Popular FSH Receptor / FSHR Antibodies

Anti-FSH Receptor / FSHR Antibody (N-Terminus) IHC-plus™ LS-A2231
Rabbit Polyclonal to Human FSH Receptor / FSHR
Human, Monkey
IHC - Paraffin
Immunohistochemistry Image
Anti-FSH Receptor / FSHR Antibody (N-Terminus) IHC-plus™ LS-A4004
Rabbit Polyclonal to Human FSH Receptor / FSHR
Human, Monkey, Rat, Bat, Bovine, Goat, Horse, Pig, Rabbit, Sheep
IHC - Paraffin
Immunohistochemistry Image

100% Guaranteed 100% Guaranteed
Rabbit Polyclonal (IgG) to Human FSH Receptor / FSHR
Western blot

Human FSH Receptor / FSHR
Human (tested or 100% immunogen sequence identity)
Monkey, Rat, Bat, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Chicken (at least 90% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified

Western blot (1 - 2 µg/ml)

Specificity and Use

FSH Receptor / FSHR antibody was raised against synthetic peptide corresponding to aa626-659 from human Follicle Stimulating Hormone Receptor (coupled to BSA) (YAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Rat, Bat (97%); Marmoset, Hamster, Horse, Guinea pig (94%); Panda, Dog, Rabbit, Pig, Turkey, Sparrow, Chicken (90%); Elephant, Bovine, Cat (87%); Mouse, Sheep, Goat, Opossum (84%).
Recognizes human Follicle Stimulating Hormone Receptor at ~78kD. Species cross-reactivity: mouse, rat, rabbit.
Suitable for use in Western Blot: 1-2 ug/ml.

PBS, 50% glycerol.
Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
For research use only.

About FSH Receptor / FSHR

P23945 NM_000145 NP_000136.2

FSHR Antibody, Follitropin receptor Antibody, FSHRO Antibody, Ovarian dysgenesis 1 Antibody, FSH receptor Antibody, FSH-R Antibody, LGR1 Antibody, ODG1 Antibody

FSHR, a Glycoprotein Hormone Receptor, is required for normal ovarian development and follicle maturation in females. When activated, it stimulates ovarian follicular growth and production of estrogens, initiating a normal menstrual cycle. In males, FSHR is required for the initiation of spermatogenesis and normal sperm production. Two isoforms are produced by alternative splicing.

Requested From: United States
Date Requested: 10/23/2016

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2016 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy
Catalog Number