Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331489-20 20 µl $263 
LS-C331489-50 50 µl $301 
LS-C331489-100 100 µl $359 
LS-C331489-200 200 µl $473 
FSH Receptor / FSHR Antibody - Western blot analysis of extracts of various cell lines, using FSHR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 20s.
FSH Receptor / FSHR Antibody - Western blot analysis of extracts of various cell lines, using FSHR antibody.
FSH Receptor / FSHR Antibody - Western blot analysis of extracts of various cell lines, using FSHR antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 20s.
FSH Receptor / FSHR Antibody - Western blot analysis of extracts of various cell lines, using FSHR antibody.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human FSH Receptor / FSHR Antibody (WB) LS‑C331489

Polyclonal Rabbit anti‑Human FSH Receptor / FSHR Antibody (WB) LS‑C331489

Antibody:
FSH Receptor / FSHR Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331489-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
FSH Receptor / FSHR Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
FSHR antibody LS-C331489 is an unconjugated rabbit polyclonal antibody to FSHR (FSH Receptor) from human. It is reactive with human and mouse. Validated for WB.
Target
Human FSH Receptor / FSHR
Synonyms
FSHR | FSHRO | Ovarian dysgenesis 1 | FSH receptor | FSH-R | LGR1 | ODG1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 631-695 of human FSHR (NP_000136.2). KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
Specificity
Human FSH Receptor / FSHR
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 71kDa/75kDa/78kDa/81kDa, while the observed MW by Western blot was 78kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FSH Receptor / FSHR
P23945 NM_000145 NP_000136.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022