Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C749939-20 20 µl $253 
LS-C749939-50 50 µl $279 
LS-C749939-100 100 µl $333 
LS-C749939-200 200 µl $429 

Polyclonal Rabbit anti‑Human AMICA / JAML Antibody (WB) LS‑C749939

Polyclonal Rabbit anti‑Human AMICA / JAML Antibody (WB) LS‑C749939

AMICA / JAML Rabbit anti-Human Polyclonal Antibody
Human, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


AMICA / JAML Rabbit anti-Human Polyclonal Antibody
Human, Rat
Unconjugated, Unmodified


JAML antibody LS-C749939 is an unconjugated rabbit polyclonal antibody to JAML (AMICA) from human. It is reactive with human and rat. Validated for WB.
AMICA1 | AMICA | CREA7-1 | CREA7-4 | Adhesion molecule AMICA | Gm638 | Junctional adhesion molecule | JAML
Human, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 285-384 of human AMICA1 (NP_694938.2). IVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF
  • Western blot (1:500 - 1:2000)
The predicted MW is 29kDa/40kDa/43kDa/44kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
Q86YT9 NP_694938.2

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/14/2021