LSBio The Immunohistochemistry Antibody Company
  • Home
  • Antibodies
    • Primary Antibodies
    • Secondary Antibodies
    • IHC-plus Antibodies
    • Isotype Control Antibodies
    • Blocking Peptides
  • ELISA Kits
    • All Kits
    • Sandwich ELISA Kits
    • EIA Kits
    • Cell-Based ELISA Kits
    • DNA-Binding ELISA Kits
    • Direct ELISA Kits
    • Functional ELISA Kits
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Secure FTP Login
    • IHC Database Login
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C188794 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



TERT / Telomerase Antibodies

telomerase reverse transcriptase

Expressed at high levels in primary tumors and cancer cell lines. Ectopic expression of telomerase in normal human cells extends their replicative life span, though cells with forced expression of telomerase retain normal growth control and display no changes associated with the malignant transformation, such as growth in soft agar or tumor formation in vivo.

Gene Name: telomerase reverse transcriptase
Synonyms: TERT Antibody, DKCB4 Antibody, EST2 Antibody, HEST2 Antibody, PFBMFT1 Antibody, Telomerase Antibody, TP2 Antibody, DKCA2 Antibody, HTRT Antibody, TCS1 Antibody, Telomerase catalytic subunit Antibody, TRT Antibody
Target Sequences: AY007685 AAG23289.1 O14746
 TERT / Telomerase Feature Table
Featured Image

Featured TERT / Telomerase Antibody

LS-B59 is a rabbit polyclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.

Publications (9)

1
Evolving views of telomerase and cancer. Blasco MA, Hahn WC. Trends in cell biology. 2003 13:289-94. [PubMed:12791294] Related Antibodies: LS-B95.
2
The telomerase reverse transcriptase regulates chromatin state and DNA damage responses. Masutomi K, Possemato R, Wong JM, Currier JL, Tothova Z, Manola JB, Ganesan S, Lansdorp PM, Collins K, Hahn WC. Proceedings of the National Academy of Sciences of the United States of America. 2005 102:8222-7. (WB; Human) [PubMed:15928077] [PMC:PMC1149439] Related Antibodies: LS-B95.
3
Immunodetection of human telomerase reverse-transcriptase (hTERT) re-appraised: nucleolin and telomerase cross paths. Wu YL, Dudognon C, Nguyen E, Hillion J, Pendino F, Tarkanyi I, Aradi J, Lanotte M, Tong JH, Chen GQ, Sgal-Bendirdjian E. Journal of cell science. 2006 119:2797-806. [PubMed:16772337] Related Antibodies: LS-B59.
4
Antigenic profiling of glioma cells to generate allogeneic vaccines or dendritic cell-based therapeutics. Zhang JG, Eguchi J, Kruse CA, Gomez GG, Fakhrai H, Schroter S, Ma W, Hoa N, Minev B, Delgado C, Wepsic HT, Okada H, Jadus MR. Clinical cancer research : an official journal of the American Association for Cancer Research. 2007 13:566-75. (ICC, Flo; Human) [PubMed:17255279] Related Antibodies: LS-B95.
5
Quantitation of HER2 and telomerase biomarkers in solid tumors with IgY antibodies and nanocrystal detection. Xiao Y, Gao X, Gannot G, Emmert-Buck MR, Srivastava S, Wagner PD, Amos MD, Barker PE. International journal of cancer. Journal international du cancer. 2008 122:2178-86. [PubMed:18214859] Related Antibodies: LS-B95.
6
Telomerase does not counteract telomere shortening but protects mitochondrial function under oxidative stress. Ahmed S, Passos JF, Birket MJ, Beckmann T, Brings S, Peters H, Birch-Machin MA, von Zglinicki T, Saretzki G. Journal of cell science. 2008 121:1046-53. [PubMed:18334557] Related Antibodies: LS-B59.
7
Quantitative nuclear proteomics identifies mTOR regulation of DNA damage response. Bandhakavi S, Kim YM, Ro SH, Xie H, Onsongo G, Jun CB, Kim DH, Griffin TJ. Molecular & cellular proteomics : MCP. 2010 9:403-14. (WB; Human) [PubMed:19955088] [PMC:PMC2830849]
8
EGFR overexpression induces activation of telomerase via PI3K/AKT-mediated phosphorylation and transcriptional regulation through Hif1-alpha in a cellular model of oral-esophageal carcinogenesis. Heeg S, Hirt N, Queisser A, Schmieg H, Thaler M, Kunert H, Quante M, Goessel G, von Werder A, Harder J, Beijersbergen R, Blum HE, Nakagawa H, Opitz OG. Cancer science. 2011 102:351-60. (WB; Human) [PubMed:21156006] Related Antibodies: LS-B95.
9
A functional tandem-repeats polymorphism in the downstream of TERT is associated with the risk of nasopharyngeal carcinoma in Chinese population. Zhang Y, Zhang H, Zhai Y, Wang Z, Ma F, Wang H, Li P, Zhang Y, Yu L, Cui Y, He F, Zhou G. BMC medicine. 2011 20:106. (IHC-P; Human) [PubMed:21929825] [PMC:PMC3191471]
more

Loading ...

Target Reactivity Applications Host Isotype Clonality Clone Format Epitope Publications Type
TERT / Telomerase Rabbit Polyclonal Unconjugated Human IHC-P, IF, WB, IP, ELISA aa1104-1123 Yes Primary
Anti-TERT / Telomerase Antibody (aa1104-1123) IHC-plus™ LS-B59
PublicationsPublications (2)
IHC Image
ICC Image
Rabbit Polyclonal to Human TERT / Telomerase
Human
IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation, ELISA
Unconjugated
TERT / Telomerase Mouse IgM Monoclonal 2D8 Unconjugated Human IHC-P, IF, WB Yes Primary
Anti-TERT / Telomerase Antibody (clone 2D8) IHC-plus™ LS-B95
PublicationsPublications (5)
IHC Image
Mouse Monoclonal [clone 2D8] (IgM) to Human TERT / Telomerase
Human
IHC - Paraffin, Immunofluorescence, Western blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human, Mouse IHC-P, ICC, IF, WB Internal No Primary
Anti-TERT / Telomerase Antibody (Internal) IHC-plus™ LS-B9932
IHC Image
WB Image
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human, Mouse
IHC - Paraffin, ICC, Immunofluorescence, Western blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human WB, ELISA aa796-845 No Primary
Anti-TERT / Telomerase Antibody (aa796-845) LS-C118019
WB Image
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human IHC-P, IF, WB, Flo aa627-656 No Primary
Anti-TERT / Telomerase Antibody (aa627-656) IHC-plus™ LS-B11086
IHC Image
IF Image
Rabbit Polyclonal to Human TERT / Telomerase
Human
IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human IHC-P, IF, WB, Flo Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125) LS-C98110
IHC Image
Flo Image
Rabbit Polyclonal to Human TERT / Telomerase
Human
IHC - Paraffin, Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human IHC, WB No Primary
Anti-TERT / Telomerase Antibody LS-C332314
IHC Image
WB Image
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
IHC, Western blot
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human IHC, WB No Primary
Anti-TERT / Telomerase Antibody LS-C341327
Rabbit Polyclonal to Human TERT / Telomerase
Human
IHC, Western blot
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human IF, DB pTyr707 No Primary
Anti-TERT / Telomerase Antibody (phospho-Tyr707) LS-C100313
DB Image
DB Image
Rabbit Polyclonal to Human TERT / Telomerase
Human
Immunofluorescence, Dot Blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human WB, ELISA aa787-1084 No Primary
Anti-TERT / Telomerase Antibody (aa787-1084) LS-C296588
WB Image
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Rat WB, ELISA aa673-976 No Primary
Anti-TERT / Telomerase Antibody (aa673-976) LS-C296589
WB Image
Rabbit Polyclonal (IgG) to Rat TERT / Telomerase
Rat
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Mouse WB, ELISA aa642-974 No Primary
Anti-TERT / Telomerase Antibody (aa642-974) LS-C296590
WB Image
Rabbit Polyclonal (IgG) to Mouse TERT / Telomerase
Mouse
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human IF, ELISA aa196-245 No Primary
Anti-TERT / Telomerase Antibody (aa196-245) LS-C118018
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Immunofluorescence, ELISA
Unconjugated
TERT / Telomerase Goat Polyclonal Unconjugated Human WB, ELISA aa597-611 No Primary
Anti-TERT / Telomerase Antibody (aa597-611) LS-C154896
WB Image
Goat Polyclonal to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human IF, ELISA pSer227 No Primary
Anti-TERT / Telomerase Antibody (phospho-Ser227) LS-C199642
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Immunofluorescence, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human WB, ELISA pSer824 No Primary
Anti-TERT / Telomerase Antibody (phospho-Ser824) LS-C199643
WB Image
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human DB pSer1125 No Primary
Anti-TERT / Telomerase Antibody (phospho-Ser1125) LS-C96567
DB Image
Rabbit Polyclonal to Human TERT / Telomerase
Human
Dot Blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Mouse, Rat WB aa15-30 No Primary
Anti-TERT / Telomerase Antibody (aa15-30) LS-C312849
WB Image
Rabbit Polyclonal (IgG) to Mouse TERT / Telomerase
Mouse, Rat
Western blot
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human WB C-Terminus No Primary
Anti-TERT / Telomerase Antibody (C-Terminus) LS-C201208
WB Image
Rabbit Polyclonal to Human TERT / Telomerase
Human
Western blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Mouse WB, ELISA aa642-974 No Primary
Anti-TERT / Telomerase Antibody (aa642-974, Biotin) LS-C299326
Rabbit Polyclonal (IgG) to Mouse TERT / Telomerase
Mouse
Western blot, ELISA
Biotin Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Rat WB, ELISA aa673-976 No Primary
Anti-TERT / Telomerase Antibody (aa673-976, Biotin) LS-C300556
Rabbit Polyclonal (IgG) to Rat TERT / Telomerase
Rat
Western blot, ELISA
Biotin Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human WB, ELISA No Primary
Anti-TERT / Telomerase Antibody LS-C285702
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Human WB, ELISA aa787-1084 No Primary
Anti-TERT / Telomerase Antibody (aa787-1084, Biotin) LS-C298162
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Biotin Conjugated
TERT / Telomerase Rabbit IgG Polyclonal FITC Conjugated Human WB, ELISA No Primary
Anti-TERT / Telomerase Antibody (FITC) LS-C317264
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
FITC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal HRP Conjugated Human WB, ELISA No Primary
Anti-TERT / Telomerase Antibody (HRP) LS-C317265
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
HRP Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Human WB, ELISA No Primary
Anti-TERT / Telomerase Antibody (Biotin) LS-C317270
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Biotin Conjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human, Mouse, Rat WB No Primary
Anti-TERT / Telomerase Antibody LS-C147053
Rabbit Polyclonal to Human TERT / Telomerase
Human, Mouse, Rat
Western blot
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human, Mouse, Rat WB pSer824 No Primary
Anti-TERT / Telomerase Antibody (phospho-Ser824) LS-C191890
Rabbit Polyclonal to Human TERT / Telomerase
Human, Mouse, Rat
Western blot
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human WB Arg223 No Primary
Anti-TERT / Telomerase Antibody (Arg223) LS-C193118
Rabbit Polyclonal to Human TERT / Telomerase
Human
Western blot
Unconjugated
TERT / Telomerase Rabbit Polyclonal Unconjugated Human, Mouse, Rat WB No Primary
Anti-TERT / Telomerase Antibody LS-C340901
Rabbit Polyclonal to Human TERT / Telomerase
Human, Mouse, Rat
Western blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal FITC Conjugated Human WB aa787-1084 No Primary
Anti-TERT / Telomerase Antibody (aa787-1084, FITC) LS-C302684
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot
FITC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal FITC Conjugated Rat WB aa673-976 No Primary
Anti-TERT / Telomerase Antibody (aa673-976, FITC) LS-C302855
Rabbit Polyclonal (IgG) to Rat TERT / Telomerase
Rat
Western blot
FITC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal FITC Conjugated Human ELISA, DB Tyr707 No Primary
Anti-TERT / Telomerase Antibody (Tyr707, FITC) LS-C283473
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
FITC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal PE Conjugated Human ELISA, DB Tyr707 No Primary
Anti-TERT / Telomerase Antibody (Tyr707, PE) LS-C283474
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
PE Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Mouse WB, ELISA No Primary
Anti-TERT / Telomerase Antibody LS-C10505
Rabbit Polyclonal (IgG) to Mouse TERT / Telomerase
Mouse
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal APC Conjugated Human ELISA, DB Tyr707 No Primary
Anti-TERT / Telomerase Antibody (Tyr707, APC) LS-C283469
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
APC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Human ELISA, DB Tyr707 No Primary
Anti-TERT / Telomerase Antibody (Tyr707, Biotin) LS-C283470
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
Biotin Conjugated
TERT / Telomerase Rabbit IgG Polyclonal HRP Conjugated, Azide-free Human ELISA, DB Tyr707 No Primary
Anti-TERT / Telomerase Antibody (Tyr707, Azide-free, HRP) LS-C283472
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
HRP Conjugated, Azide-free
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human ELISA, DB pSer1125 No Primary
Anti-TERT / Telomerase Antibody (phospho-Ser1125) LS-C328860
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125) LS-C328861
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human ELISA, DB pTyr707 No Primary
Anti-TERT / Telomerase Antibody (phospho-Tyr707) LS-C328863
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Mouse, Human, Rat WB, ELISA Internal No Primary
Anti-TERT / Telomerase Antibody (Internal) LS-C10506
Rabbit Polyclonal (IgG) to Mouse TERT / Telomerase
Mouse, Human, Rat
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Human WB, ELISA Internal No Primary
Anti-TERT / Telomerase Antibody (Internal) LS-C10510
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal Unconjugated Yeast WB, ELISA N-Terminus No Primary
Anti-TERT / Telomerase Antibody (N-Terminus) LS-C10515
Rabbit Polyclonal (IgG) to Yeast TERT / Telomerase
Yeast
Western blot, ELISA
Unconjugated
TERT / Telomerase Rabbit IgG Polyclonal AP Conjugated Human ELISA, DB Tyr707 No Primary
Anti-TERT / Telomerase Antibody (Tyr707, AP) LS-C283468
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
AP Conjugated
TERT / Telomerase Rabbit IgG Polyclonal FITC Conjugated Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, FITC) LS-C283459
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
FITC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal HRP Conjugated, Azide-free Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, Azide-free, HRP) LS-C283460
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
HRP Conjugated, Azide-free
TERT / Telomerase Rabbit IgG Polyclonal PE Conjugated Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, PE) LS-C283461
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
PE Conjugated
TERT / Telomerase Rabbit IgG Polyclonal AP Conjugated Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, AP) LS-C283456
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
AP Conjugated
TERT / Telomerase Rabbit IgG Polyclonal APC Conjugated Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, APC) LS-C283457
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
APC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Human WB, ELISA Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, Biotin) LS-C283458
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot, ELISA
Biotin Conjugated
TERT / Telomerase Rabbit IgG Polyclonal FITC Conjugated Human ELISA, DB Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, FITC) LS-C283465
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
FITC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal HRP Conjugated, Azide-free Human ELISA, DB Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, Azide-free, HRP) LS-C283466
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
HRP Conjugated, Azide-free
TERT / Telomerase Rabbit IgG Polyclonal PE Conjugated Human ELISA, DB Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, PE) LS-C283467
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
PE Conjugated
TERT / Telomerase Rabbit IgG Polyclonal AP Conjugated Human ELISA, DB Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, AP) LS-C283462
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
AP Conjugated
TERT / Telomerase Rabbit IgG Polyclonal APC Conjugated Human ELISA, DB Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, APC) LS-C283463
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
APC Conjugated
TERT / Telomerase Rabbit IgG Polyclonal Biotin Conjugated Human ELISA, DB Ser1125 No Primary
Anti-TERT / Telomerase Antibody (Ser1125, Biotin) LS-C283464
Rabbit Polyclonal (IgG) to Human TERT / Telomerase
Human
ELISA, Dot Blot
Biotin Conjugated
TERT / Telomerase Goat IgG Polyclonal Unconjugated Human WB C-Terminus No Primary
Anti-TERT / Telomerase Antibody (C-Terminus) LS-C132393
Goat Polyclonal (IgG) to Human TERT / Telomerase
Human
Western blot
Unconjugated
TERT / Telomerase Mouse IgM Monoclonal Unconjugated Human WB No Primary
Anti-TERT / Telomerase Antibody LS-C92682
Mouse Monoclonal (IgM) to Human TERT / Telomerase
Human
Western blot
Unconjugated
Target Corresponding Antibodies
TERT / Telomerase
TERT / Telomerase Antibody Blocking Peptide - LS-E2979
LS-E2979
TERT / Telomerase
LS-B11086
TERT / Telomerase
TERT / Telomerase Antibody Blocking Peptide - LS-E2980
LS-E2980
TERT / Telomerase
LS-C98110
TERT / Telomerase
TERT / Telomerase Antibody Blocking Peptide - LS-E7414
LS-E7414
TERT / Telomerase
LS-C96567
TERT / Telomerase
TERT / Telomerase Antibody Blocking Peptide - LS-E7443
LS-E7443
TERT / Telomerase
LS-C100313
TERT / Telomerase
TERT / Telomerase Antibody Blocking Peptide - LS-E27822
LS-E27822
TERT / Telomerase
LS-C154896
Type Target Reactivity Sample Type
Cell-Based Phosphorylation TERT / Telomerase Human Adherent Cell Cultures
Human Phospho-TERT / Telomerase (Ser824) Cell-Based ELISA Kit - LS-F1428
Cell-Based Phosphorylation
Human
96-Well Microplate with Colorimetric - 450nm detection type
Adherent Cell Cultures
Cell-Based TERT / Telomerase Human Adherent Cell Cultures
Human TERT / Telomerase Cell-Based ELISA Kit - LS-F2346
Cell-Based
Human
96-Well Microplate with Colorimetric - 450nm detection type
Adherent Cell Cultures
Sandwich TERT / Telomerase Human Cell Lysates, Tissue Homogenates
Human TERT / Telomerase ELISA Kit - LS-F7351
Sandwich
Human
96-Well Strip Plate with Colorimetric - 450nm detection type
Cell Lysates, Tissue Homogenates
Sandwich TERT / Telomerase Rat Plasma, Serum
Rat TERT / Telomerase ELISA Kit - LS-F9171
Sandwich
Rat
96-Well Strip Plate with Colorimetric - 450nm detection type
Plasma, Serum

TERT / Telomerase Feature Table


Feature Type Location Details
alternative products 1 - 1132 Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O14746-1; Sequence=Displayed; Name=2; IsoId=O14746-2; Sequence=VSP_019587, VSP_019588; Note=Phosphorylated on Ser-797; Name=3; IsoId=O14746-3; Sequence=VSP_021727; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available;
catalytic activity 1 - 1132 Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
Disease 1 - 1132 Defects in TERT are a cause of dyskeratosis congenita autosomal dominant (ADDKC) [MIM:127550]; also known as dyskeratosis congenita Scoggins type. ADDKC is a rare, progressive bone marrow failure syndrome characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.
Disease 1 - 1132 Defects in TERT are a cause of susceptibility to pulmonary fibrosis idiopathic (IPF) [MIM:178500]. Pulmonary fibrosis is a lung disease characterized by shortness of breath, radiographically evident diffuse pulmonary infiltrates, and varying degrees of inflammation and fibrosis on biopsy. It results in acute lung injury with subsequent scarring and endstage lung disease.
Disease 1 - 1132 Defects in TERT are associated with susceptibilty to aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
Disease 1 - 1132 Note=Activation of telomerase has been implicated in cell immortalization and cancer cell pathogenesis.
Disease 1 - 1132 Note=Genetic variations in TERT are associated with coronary artery disease (CAD).
domain 1 - 1132 The primer grip sequence in the RT domain is required for telomerase activity and for stable association with short telomeric primers.
domain 1 - 1132 The RNA-interacting domain 1 (RD1)/N-terminal extension (NTE) is required for interaction with the pseudoknot-template domain of each of TERC dimers. It contains anchor sites that bind primer nucleotides upstream of the RNA-DNA hybrid and is thus an essential determinant of repeat addition processivity.
domain 1 - 1132 The RNA-interacting domain 2 (RD2) is essential for both interaction with the CR4-CR5 domain of TERC and for DNA sythesis.
Function 1 - 1132 Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA- dependent extension of 3'-chromosomal termini with the 6- nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regula
Induction 1 - 1132 Activated by cytotoxic events and down-regulated during aging. In peripheral T lymphocytes, induced By CD3 and by PMA/ionomycin. Inhibited by herbimycin B.
interaction 1 - 1132 Q9Y265:RUVBL1; NbExp=2; IntAct=EBI-1772203, EBI-353675;
ptm 1 - 1132 Phosphorylation at Tyr-707 under oxidative stress leads to translocation of TERT to the cytoplasm and reduces its antiapoptotic activity. Dephosphorylated by SHP2/PTPN11 leading to nuclear retention. Phosphorylation by the AKT pathway promotes nuclear location.
ptm 1 - 1132 Ubiquitinated, leading to proteasomal degradation.
Similarity 1 - 1132 Belongs to the reverse transcriptase family. Telomerase subfamily.
Similarity 1 - 1132 Contains 1 reverse transcriptase domain.
Subcellular Location 1 - 1132 Nucleus, nucleolus. Nucleus, nucleoplasm. Nucleus. Telomere. Cytoplasm. Note=Shuttling between nuclear and cytoplasm depends on cell cycle, phosphorylation states, transformation and DNA damage. Diffuse localization in the nucleoplasm. Enriched in nucleoli of certain cell types. Translocated to the cytoplasm via nuclear pores in a CRM1/RAN- dependent manner involving oxidative stress-mediated phosphorylation at Tyr-707. Dephosphorylation at this site by SHP2 retains TERT in the nucleus. Translocated to the nucleus by phosphorylation by AKT.
Subunit 1 - 1132 Homodimer; dimerization is required to produce a functional complex. Oligomer; can form oligomers in the absence of the telomerase RNA template component (TERC). Catalytic subunit of the telomerase holoenzyme complex composed minimally of TERT and TERC. The telomerase complex is composed of TERT, DKC1, WDR79/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). The molecular chaperone HSP90/P23 complex is required for correct assembly and stabilization of the active telomerase. Interacts directly with HSP90A and PTGES3. Interacts with HSPA1A; the interaction occurs in the absence of TERC and dissociates once the complex has formed. Interacts with RAN; the interaction promotes nuclear export of TERT. Interacts with XPO1. Interacts with PTPN11; the interaction retains TERT in the nucleus. Interacts with NCL (via RRM1 and C-terminal RRM4/Arg/G
Tissue Specificity 1 - 1132 Expressed at a high level in thymocyte subpopulations, at an intermediate level in tonsil T lymphocytes, and at a low to undetectable level in peripheral blood T lymphocytes.
web resource 1 - 1132 Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/tert/";
bgee 1 - 1132 O14746
brenda 1 - 1132 2.7.7.49
cleanex 1 - 1132 HS_TERT
ctd 1 - 1132 7015
doi 1 - 1132 10
eggnog 1 - 1132 prNOG04020
embl 1 - 1132 AB085628
embl 1 - 1132 AB086379
embl 1 - 1132 AF015950
embl 1 - 1132 AF018167
embl 1 - 1132 AF128893
embl 1 - 1132 AF128894
embl 1 - 1132 AY007685
embl 1 - 1132 DQ264729
ensembl 1 - 1132 ENST00000310581
genecards 1 - 1132 GC05M001306
geneid 1 - 1132 7015
genevestigator 1 - 1132 O14746
germonline 1 - 1132 ENSG00000164362
go 1 - 1132 GO:0000783
go 1 - 1132 GO:0003721
go 1 - 1132 GO:0005654
go 1 - 1132 GO:0005697
go 1 - 1132 GO:0005730
go 1 - 1132 GO:0005737
go 1 - 1132 GO:0006916
go 1 - 1132 GO:0007004
go 1 - 1132 GO:0010149
go 1 - 1132 GO:0022616
go 1 - 1132 GO:0032203
go 1 - 1132 GO:0042162
go 1 - 1132 GO:0042803
go 1 - 1132 GO:0070034
h-invdb 1 - 1132 HIX0031945
hgnc 1 - 1132 HGNC:11730
hogenom 1 - 1132 HBG282044
hovergen 1 - 1132 HBG000460
inparanoid 1 - 1132 O14746
intact 1 - 1132 O14746
interpro 1 - 1132 IPR000477
interpro 1 - 1132 IPR003545
interpro 1 - 1132 IPR021891
ipi 1 - 1132 IPI00168908
ipi 1 - 1132 IPI00298218
ipi 1 - 1132 IPI00384469
kegg 1 - 1132 hsa:7015
medline 1 - 1132 20483767
medline 1 - 1132 22751969
medline 1 - 1132 97400623
medline 1 - 1132 97433088
medline 1 - 1132 98051184
medline 1 - 1132 99267414
mim 1 - 1132 127550
mim 1 - 1132 178500
mim 1 - 1132 187270
mim 1 - 1132 609135
mint 1 - 1132 MINT-133963
nextbio 1 - 1132 27405
oma 1 - 1132 VETIFLG
orphanet 1 - 1132 1775
orphanet 1 - 1132 2032
orphanet 1 - 1132 88
orthodb 1 - 1132 EOG9P2SNQ
pathway_interaction_db 1 - 1132 hif1_tfpathway
pathway_interaction_db 1 - 1132 il2_pi3kpathway
pathway_interaction_db 1 - 1132 telomerasepathway
pdb 1 - 1132 2BCK
pdbsum 1 - 1132 2BCK
pfam 1 - 1132 PF00078
pfam 1 - 1132 PF12009
pharmgkb 1 - 1132 PA36447
phosphosite 1 - 1132 O14746
phylomedb 1 - 1132 O14746
pir 1 - 1132 T03844
pride 1 - 1132 O14746
prints 1 - 1132 PR01365
prosite 1 - 1132 PS50878
proteinmodelportal 1 - 1132 O14746
pubmed 1 - 1132 10333526
pubmed 1 - 1132 11029039
pubmed 1 - 1132 11274138
pubmed 1 - 1132 12808100
pubmed 1 - 1132 12869302
pubmed 1 - 1132 14654914
pubmed 1 - 1132 14963003
pubmed 1 - 1132 15044100
pubmed 1 - 1132 15082768
pubmed 1 - 1132 15138842
pubmed 1 - 1132 15371412
pubmed 1 - 1132 15805468
pubmed 1 - 1132 15814878
pubmed 1 - 1132 15857955
pubmed 1 - 1132 15885610
pubmed 1 - 1132 16094384
pubmed 1 - 1132 16247010
pubmed 1 - 1132 16323248
pubmed 1 - 1132 16332973
pubmed 1 - 1132 16565220
pubmed 1 - 1132 16627250
pubmed 1 - 1132 16890917
pubmed 1 - 1132 16990594
pubmed 1 - 1132 17026956
pubmed 1 - 1132 17264120
pubmed 1 - 1132 17296728
pubmed 1 - 1132 17392301
pubmed 1 - 1132 17460043
pubmed 1 - 1132 17548608
pubmed 1 - 1132 17785587
pubmed 1 - 1132 18082603
pubmed 1 - 1132 18829466
pubmed 1 - 1132 19147845
pubmed 1 - 1132 19179534
pubmed 1 - 1132 19188162
pubmed 1 - 1132 19571879
pubmed 1 - 1132 19760749
pubmed 1 - 1132 19777057
pubmed 1 - 1132 8676067
pubmed 1 - 1132 9252327
pubmed 1 - 1132 9288757
pubmed 1 - 1132 9389643
pubmed 1 - 1132 9443919
reactome 1 - 1132 REACT_22172
refseq 1 - 1132 NP_937983.2
refseq 1 - 1132 NP_937986.1
smr 1 - 1132 O14746
string 1 - 1132 O14746
ucsc 1 - 1132 uc003jca.1
ucsc 1 - 1132 uc003jcc.1
unigene 1 - 1132 Hs.492203
joined; genomic_dna 1 - 1132 AAD30037.1
act_site 712 - 712 Probable
act_site 868 - 868 Probable
act_site 869 - 869 Probable
chain 1 - 1132 Telomerase reverse transcriptase /FTId=PRO_0000054925.
conflict 516 - 516 D -> G (in Ref. 1; AAC51724)
domain 605 - 935 Reverse transcriptase
Modification 707 - 707 Phosphotyrosine; by SRC-type Tyr-kinases
Modification 1113 - 1113 Phosphothreonine
Modification 1125 - 1125 Phosphoserine
mutagen 137 - 141 WGLLL->AAAAA: Reduced catalytic activity and repeat addition processivity. Complete loss of catalytic activity but no loss of binding to telomeric primers; when associated with 930-A--A-934.
mutagen 169 - 169 Q->A: About 80% loss of enzymatic activity. Greatly reduced incorporation of second nucleotide. Altered strength of binding to ssDNA. Little effect on repeat addition processivity, nor on TR interaction nor on protein levels.
mutagen 169 - 169 Q->N: About 85% loss of enzymatic activity. Greatly reduced incorporation of second nucleotide. Altered strength of binding to ssDNA. No effect on protein levels nor on TR interaction.
mutagen 169 - 169 Q->T: About 90% loss of enzymatic activity. Greatly reduced incorporation of second nucleotide. Altered strength of binding to ssDNA. No effect on protein levels nor on TR interaction.
mutagen 547 - 547 W->A: Defective in high-affinity TERC interactions.
mutagen 631 - 631 R->A: Abolishes telomerase catalytic activity.
mutagen 707 - 707 Y->F: Abolishes oxidative stress-induced phosphorylation and RAN binding. Impaired nuclear export and enhanced antiapoptotic activity against ROS-dependent apoptosis induction. Impaired interaction with PTPN11. No dephosphorylation by PTPN11.
mutagen 712 - 712 D->A: Loss of telomerase activity. In the absence of TR, no loss of binding to telomeric primers.
mutagen 866 - 866 L->Y: Moderate reduction in telomerase activity, no change in repeat extension rate nor on nucleotide incorporation fidelity. Little further reduction in activity but 13.5-fold increase in nucleotide incorporation fidelity; when associated with M-867.
mutagen 867 - 867 V->A: About 75% reduction in telomerase activity, about 80% reduction in repeat reduction rate and 3.9-fold increase in nucleotide incorporation fidelity.
mutagen 867 - 867 V->M: About 75% reduction in telomerase activity, about 50% reduction in repeat extension rate and 5.2-fold increase in nucleotide incorporation fidelity. Little further reduction in activity and 13.5- fold increase in nucleotide incorporation fidelity; when associated with Y-866.
mutagen 867 - 867 V->T: Severe reduction in telomerase activity, about 50% reduction in repeat extension rate and 2.2-fold increase in nucleotide incorporation fidelity. No further reduction in activity but 2.8- fold increase in nucleotide incorporation fidelity; when associated with Y-866.
mutagen 868 - 868 D->A: Loss of telomerase activity
mutagen 868 - 869 DD->AA: Loss of telomerase activity
mutagen 869 - 869 D->A: Loss of telomerase activity
mutagen 930 - 934 WCGLL->AAAAA: Completely abolishes telomerase-mediated primer extension and reduced binding to short telomeric primers. Complete loss of catalytic activity but no further loss of binding to telomeric primers; when associated with 137-A--A-141.
region 1 - 230 RNA-interacting domain 1
region 58 - 197 GQ motif
region 137 - 141 Required for regulating specificity for telomeric DNA and for processivity for primer elongation.
region 231 - 324 Linker
region 301 - 538 Required for oligomerization
region 325 - 550 RNA-interacting domain 2
region 376 - 521 QFP motif
region 397 - 417 CP motif
region 914 - 928 Required for oligomerization
region 930 - 934 Primer grip sequence
region 936 - 1132 CTE
site 169 - 169 Required for optimal binding of telomeric ssDNA and incorporation of nucleotides at the second position of the template.
site 867 - 867 Required for nucleotide incorporation and primer extension rate.
var_seq 764 - 807 STLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSG LFD -> LRPVPGDPAGLHPLHAALQPVLRRHGEQAVCGDS AGRAAPAFGG (in isoform 2). /FTId=VSP_019587.
var_seq 808 - 1132 Missing (in isoform 2) /FTId=VSP_019588.
var_seq 885 - 947 Missing (in isoform 3) /FTId=VSP_021727.
variant 55 - 55 L -> Q (in idiopathic pulmonary fibrosis susceptibility; impaired telomerase acivity). /FTId=VAR_062535.
variant 65 - 65 P -> A (associated with acute myeloid leukemia). /FTId=VAR_062780.
variant 202 - 202 A -> T (in AA susceptibility; severe and moderate; shorter telomeres). /FTId=VAR_036863.
variant 279 - 279 A -> T /FTId=VAR_036864.
variant 299 - 299 V -> M (associated with acute myeloid leukemia). /FTId=VAR_062781.
variant 412 - 412 H -> Y (in AA susceptibility; severe and moderate; associated with susceptibility to acute myelogenous leukemia; dbSNP:rs34094720). /FTId=VAR_025149.
variant 441 - 441 Missing (in AA susceptibility; associated with susceptibility to acute myeloid leukemia). /FTId=VAR_036865.
variant 522 - 522 R -> K (associated with acute myeloid leukemia). /FTId=VAR_062782.
variant 570 - 570 K -> N (in AA susceptibility; abolishes telomerase catalytic activity but no effect on binding to TERC). /FTId=VAR_062536.
variant 631 - 631 R -> Q (in AA susceptibility) /FTId=VAR_062783.
variant 682 - 682 G -> D (in AA susceptibility; non-severe; abolishes telomerase catalytic activity but little effect on binding to TERC). /FTId=VAR_062537.
variant 694 - 694 V -> M (in AA susceptibility; moderate) /FTId=VAR_036866.
variant 721 - 721 P -> R (in a family with autosomal recessive DKC; no effect on telomerase catalytic activity and little effect on binding to TERC). /FTId=VAR_062538.
variant 726 - 726 T -> M (in AA susceptibility; very severe; no effect on telomerase catalytic activity but shortened telomeres). /FTId=VAR_062539.
variant 772 - 772 Y -> C (in AA susceptibility; moderate) /FTId=VAR_036867.
variant 785 - 785 P -> L (in AA susceptibility) /FTId=VAR_062784.
variant 811 - 811 R -> C (in a family with autosomal recessive DKC; 50% reduction in telomerase activity). /FTId=VAR_062540.
variant 865 - 865 R -> H (in idiopathic pulmonary fibrosis susceptibility). /FTId=VAR_036868.
variant 901 - 901 R -> W (in a family with autosomal recessive DKC; severe phenotype overlapping with Hoyeraal-Hreidarsson syndrome; very short telomeres and greatly reduced telomerase activity). /FTId=VAR_062541.
variant 902 - 902 K -> N (in ADDKC; abolishes telomerase catalytic activity but no effect on binding to TERC). /FTId=VAR_036869.
variant 948 - 948 S -> R (in dbSNP:rs34062885) /FTId=VAR_053726.
variant 979 - 979 R -> W (in ADDKC; shortened telomeres but no effect on telomerase catalytic activity nor on binding to TERC). /FTId=VAR_062542.
variant 1062 - 1062 A -> T (increased incidence in sporadic acute myeloid leukemia; dbSNP:rs35719940). /FTId=VAR_025150.
variant 1090 - 1090 V -> M (in AA susceptibility; severe) /FTId=VAR_036870.
variant 1110 - 1110 T -> M (in idiopathic pulmonary fibrosis susceptibility; impaired telomerase acivity). /FTId=VAR_062543.
variant 1127 - 1127 F -> L (in ADDKC; severe; shortened telomeres but no effect on telomerase catalytic activity nor on binding to TERC). /FTId=VAR_062544.
keyword 1 - 1132 3D-structure
keyword 1 - 1132 Alternative splicing
keyword 1 - 1132 Chromosomal protein
keyword 1 - 1132 Complete proteome
keyword 1 - 1132 Cytoplasm
keyword 1 - 1132 DNA-binding
keyword 1 - 1132 Dyskeratosis congenita
keyword 1 - 1132 Nucleotidyltransferase
keyword 1 - 1132 Nucleus
keyword 1 - 1132 Phosphoprotein
keyword 1 - 1132 Polymorphism
keyword 1 - 1132 Ribonucleoprotein
keyword 1 - 1132 RNA-directed DNA polymerase
keyword 1 - 1132 Telomere
keyword 1 - 1132 Transferase
keyword 1 - 1132 Ubl conjugation
Molecular Weight 1 - 1132 126997
1 hit 1 - 1132 PF00078
1 hit 1 - 1132 PF12009
1 hit 1 - 1132 PS50878

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2015 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy