Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Locations
Orders Processing,
Shipping & Receiving,
Warehouse
2 Shaker Rd Suites
B001/B101
Shirley, MA 01464
Production Lab
Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036
Telephone Numbers
Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G136388-20 | 20 µg | $475 |
| LS-G136388-100 | 100 µg | $1,164 |
| LS-G136388-1 | 1 mg | $2,187 |
![acpS Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.](https://lsbio-7d62.kxcdn.com/image2/streptococcus-pyogenes-acps-protein-recombinant-10his-n-terminus-myc-c-terminus-full-length-ls-g136388/520589_4314791.jpg)
![acpS Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.](https://lsbio-7d62.kxcdn.com/image2/streptococcus-pyogenes-acps-protein-recombinant-10his-n-terminus-myc-c-terminus-full-length-ls-g136388/520590_4314792.jpg)
1 of 2
2 of 2
Streptococcus pyogenes acpS Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136388
Streptococcus pyogenes acpS Protein (Recombinant 10His, N-terminus + Myc, C-terminus) (Full Length) - LS-G136388
Description:
acpS Protein LS-G136388 is a Recombinant Streptococcus pyogenes acpS produced in Baculovirus 1-118aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Toll Free North America
206-374-1102
206-374-1102For Research Use Only
Overview
Description:
acpS Protein LS-G136388 is a Recombinant Streptococcus pyogenes acpS produced in Baculovirus 1-118aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
acpS
Synonyms
acpS
Species
Streptococcus pyogenes
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
1-118aa
Predicted Molecular Weight
17.1 kDa
AA Sequence
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
Expression System
Baculovirus
Source Species
Baculovirus
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About acpS
Publications (0)
Customer Reviews (0)
Images
Mass Cytometry
![acpS Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.](https://lsbio-7d62.kxcdn.com/image2/streptococcus-pyogenes-acps-protein-recombinant-10his-n-terminus-myc-c-terminus-full-length-ls-g136388/520589_4315893.jpg)
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
![acpS Protein - Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.](https://lsbio-7d62.kxcdn.com/image2/streptococcus-pyogenes-acps-protein-recombinant-10his-n-terminus-myc-c-terminus-full-length-ls-g136388/520590_4316006.jpg)
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Mass Cytometry
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase(acpS) could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/28/2024
Date Requested: 4/28/2024
