Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136948-20 20 µg $721 
LS-G136948-100 100 µg $1,128 
Rotavirus A Non-structural Glycoprotein 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Rotavirus A Non-structural Glycoprotein 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
1 of 3
2 of 3
3 of 3

Rotavirus A Non-structural Glycoprotein 4 (Recombinant 6His, N-terminus + Myc, C-terminus) - LS-G136948

Rotavirus A Non-structural Glycoprotein 4 (Recombinant 6His, N-terminus + Myc, C-terminus) - LS-G136948

Description:
Rotavirus A Non-structural Glycoprotein 4 Protein LS-G136948 is a Recombinant Rotavirus A Non-structural Glycoprotein 4 produced in E. coli 52-175aa with 6His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$721
LS-G136948-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
Rotavirus A Non-structural Glycoprotein 4 Protein LS-G136948 is a Recombinant Rotavirus A Non-structural Glycoprotein 4 produced in E. coli 52-175aa with 6His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Rotavirus A Non-structural Glycoprotein 4
Species
Rotavirus A
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus + Myc, C-terminus
Region
52-175aa
Predicted Molecular Weight
21.7 kDa
AA Sequence
PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation Enterotoxin that causes a phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma membrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Store lyophilized at -20°C or -80°C for up to 1 year. Once reconstituted: store undiluted at 4°C for up to 1 week. Aliquot and store undiluted at -20°C or -80°C for up to 6 months. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Rotavirus A Non-structural Glycoprotein 4
Q82035

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Rotavirus A Non-structural Glycoprotein 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Rotavirus A Non-structural Glycoprotein 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Rotavirus A Non-structural Glycoprotein 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Rotavirus A Non-structural Glycoprotein 4 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Mass Cytometry

Rotavirus A Non-structural Glycoprotein 4 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Rotavirus A Non-structural glycoprotein 4,partial could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/28/2024