Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G22921-20 20 µg $364 
LS-G22921-100 100 µg $499 
LS-G22921-1 1 mg $1,683 
FGF23 Protein

Rat FGF23 Protein (Recombinant His) (aa25-251) - LS-G22921

Rat FGF23 Protein (Recombinant His) (aa25-251) - LS-G22921

Description:
FGF23 Protein LS-G22921 is a Recombinant Rat FGF23 produced in Yeast aa 25-251 with His tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G22921-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
FGF23 Protein LS-G22921 is a Recombinant Rat FGF23 produced in Yeast aa 25-251 with His tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
FGF23
Synonyms
FGF23 | ADHR | Fibroblast growth factor 23 | FGF-23 | HYPF | Phosphatonin | PHPTC | HPDR2
Species
Rat
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 25-251
Predicted Molecular Weight
27.5 kD
AA Sequence
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 20 mM tris-hcl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGF23
Q9GZV9 NM_020638 NP_065689.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF23 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF23 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF23 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF23 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/25/2024