Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Infectious Disease
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G71173-20 20 µg (0.43 mg/ml) $890 
P2RY12 / P2Y12 Protein - Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Human P2RY12 / P2Y12 Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G71173

Human P2RY12 / P2Y12 Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G71173

Available for shipment within the USA only
Description:
P2RY12 / P2Y12 Protein LS-G71173 is a Recombinant Human P2RY12 / P2Y12 produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).
Price
Catalog Number
$890 
LS-G71173-20
20 µg
0.43 mg/ml

Available for shipment within the USA only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
P2RY12 / P2Y12 Protein LS-G71173 is a Recombinant Human P2RY12 / P2Y12 produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).

Specifications

Type
Recombinant Protein
Target
P2RY12 / P2Y12
Synonyms
P2RY12 | ADP-glucose receptor | ADPG-R | p2Y(12)R | p2Y(ADP) | p2T(AC) | p2Y12 | Platelet ADP receptor | SP1999 | p2RY12 | p2Y purinoceptor 12 | Purinergic receptor P2RY12 | BDPLT8 | Gi-coupled ADP receptor HORK3 | HORK3 | p2Y(AC) | p2Y(cyc) | p2Y12 platelet ADP receptor
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
39.3 kDa
AA Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
> 80% as determined by SDS-PAGE and Coomassie blue staining
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage
Store at -80°C for up to 3 months. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About P2RY12 / P2Y12
Q9H244 NM_022788 NP_073625.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RY12 / P2Y12 Protein - Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RY12 / P2Y12 Protein - Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RY12 / P2Y12 Protein - Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

P2RY12 / P2Y12 Protein - Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein P2RY12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Requested From: United States
Date Requested: 7/3/2020