Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G480-2 2 µg $268 
LS-G480-10 10 µg $349 
Protein

Human SCGF Protein (Recombinant) - LS-G480

Human SCGF Protein (Recombinant) - LS-G480

Description:
SCGF Protein LS-G480 is a Recombinant Human SCGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only
Price
Catalog Number
$268
LS-G480-2
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
SCGF Protein LS-G480 is a Recombinant Human SCGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.1 ng/µg of protein (less than 1EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
SCGF
Synonyms
CLEC11A | CLECSF3 | LSLCL | SCGF | Stem cell growth factor | p47
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
33.9 kDa
AA Sequence
GHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
Determined by its inhibitory effect on the proliferation of TF-1 cells previously grown in media containing GM-CSF. The ED50 for this effect was observed at <=2.5 ng/ml.
Endotoxin
Less than 0.1 ng/µg of protein (less than 1EU/µg).
Presentation
Sterile filtered, lyophilized with no additives.
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 12 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SCGF
Q9Y240 NM_002975 NP_002966.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/20/2024