Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G29851-10 10 µg (0.09 µg/µl) $479 
LS-G29851-25 25 µg (0.19 µg/µl) $670 
PP2Ac / PPP2CA Protein - 12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue

Human PP2Ac / PPP2CA Protein (Recombinant GST) (Full Length) - LS-G29851

Human PP2Ac / PPP2CA Protein (Recombinant GST) (Full Length) - LS-G29851

Available for shipment within the USA only
Description:
PP2Ac / PPP2CA Protein LS-G29851 is a Recombinant Human PP2Ac / PPP2CA produced in Wheat Germ Extract with GST tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G29851-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
PP2Ac / PPP2CA Protein LS-G29851 is a Recombinant Human PP2Ac / PPP2CA produced in Wheat Germ Extract with GST tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
PP2Ac / PPP2CA
Synonyms
PPP2CA | PP2Ac | PP2Calpha | ppp2A1 | Protein phosphatase 2A alpha | Replication protein C | PP2CA | RP-C | PP2A-alpha
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Predicted Molecular Weight
62 kDa
AA Sequence
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Expression System
Wheat Germ Extract
Source Species
Wheat
Purification
Glutathione Sepharose
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PP2Ac / PPP2CA
P67775 NM_002715 NP_002706.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PP2Ac / PPP2CA Protein - 12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue
12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PP2Ac / PPP2CA Protein - 12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue
12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PP2Ac / PPP2CA Protein - 12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue
12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PP2Ac / PPP2CA Protein - 12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue
12.5% SDS-PAGE of human PPP2CA stained with Coomassie Blue

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/3/2024