Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G2929-10 10 µg $276 
LS-G2929-50 50 µg (0.25 mg/ml) $411 
LS-G2929-250 250 µg (0.25 mg/ml) $985 
CHCHD8 Protein

Human CHCHD8 Protein (Recombinant His) - LS-G2929

Human CHCHD8 Protein (Recombinant His) - LS-G2929

Description:
CHCHD8 Protein LS-G2929 is a Recombinant Human CHCHD8 produced in E. coli with His tag(s). For Research Use Only
Price
Catalog Number
$276
LS-G2929-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CHCHD8 Protein LS-G2929 is a Recombinant Human CHCHD8 produced in E. coli with His tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
CHCHD8
Synonyms
COA4 | E2IG2 | CHCHD8 | CMC3
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAHH
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.15 M NaCl, 1 mM DTT, 10% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CHCHD8
Q9NYJ1 NM_016565 NP_057649.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CHCHD8 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CHCHD8 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CHCHD8 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

CHCHD8 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/21/2024