Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21670-20 20 µg $323 
LS-G21670-100 100 µg $420 
LS-G21670-1 1 mg (1 mg/ml) $1,355 
SCA2 / LY6E Protein

Human SCA2 / LY6E Protein (Recombinant 6His-SUMO, N-terminus) (aa21-101) - LS-G21670

Human SCA2 / LY6E Protein (Recombinant 6His-SUMO, N-terminus) (aa21-101) - LS-G21670

Description:
SCA2 / LY6E Protein LS-G21670 is a Recombinant Human SCA2 / LY6E produced in E. coli aa 21-101 with 6His-SUMO, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$323
LS-G21670-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
SCA2 / LY6E Protein LS-G21670 is a Recombinant Human SCA2 / LY6E produced in E. coli aa 21-101 with 6His-SUMO, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
SCA2 / LY6E
Synonyms
LY6E | 9804 | Lymphocyte antigen 6E | RIG-E | RIGE | SCA2 | SCA-2 | Ly-6E | TSA-1 | TSA1 | Retinoic acid induced gene E | Stem cell antigen 2 | Thymic shared antigen 1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
aa 21-101
Predicted Molecular Weight
24.47 kD
AA Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SCA2 / LY6E
Q16553 NM_002346 NP_002337.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SCA2 / LY6E Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SCA2 / LY6E Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SCA2 / LY6E Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SCA2 / LY6E Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/26/2024