Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G20502-20 20 µg $323 
LS-G20502-100 100 µg $420 
LS-G20502-1 1 mg $1,355 
Protein

Human ASAH2B Protein (Recombinant His) (Full Length) - LS-G20502

Human ASAH2B Protein (Recombinant His) (Full Length) - LS-G20502

Description:
ASAH2B Protein LS-G20502 is a Recombinant Human ASAH2B produced in E. coli aa 1-165 with His tag(s). For Research Use Only
Price
Catalog Number
$323
LS-G20502-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
ASAH2B Protein LS-G20502 is a Recombinant Human ASAH2B produced in E. coli aa 1-165 with His tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
ASAH2B
Synonyms
ASAH2B
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 1-165
Predicted Molecular Weight
23.11 kD
AA Sequence
MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ASAH2B

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/20/2024