Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human RPE Protein (Recombinant His) - LS-G1658

Best Seller
Catalog
Size
Price
LS-G1658-100
100 µg (0.5 mg/ml)
$315
LS-G1658-0.5
0.5 mg (0.5 mg/ml)
$695
Description
RPE Protein LS-G1658 is Recombinant Human RPE in E. coli with His tag(s).
Type
Recombinant Protein
Target
RPE
Species
Human
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Expression System
E. coli
Source Species
E. coli
Tag
His
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 200 mM NaCl, 2 mM DTT, 30% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About RPE
Q96AT9 AJ224326 CAA11895.1

Popular RPE Proteins

Protein
Source: E. coli Expression System
Tag: His
Format: Purified
12.5% SDS-PAGE of human RPE stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified
Protein
Source: E. coli Expression System
Tag: 6His,C-terminus
Format: Purified / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Purified recombinant protein RPE was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Requested From: United States
Date Requested: 9/21/2019