Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 610/620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G145709-50 50 µg $355 
LS-G145709-1 1 mg $2,500 
Protein

Human HMG1 / HMGB1 Protein (Recombinant 6His, C-terminus) - LS-G145709

Human HMG1 / HMGB1 Protein (Recombinant 6His, C-terminus) - LS-G145709

Description:
HMG1 / HMGB1 Protein LS-G145709 is a Recombinant Human HMG1 / HMGB1 produced in E. coli with 6His, C-terminus tag(s). It is low in endotoxin; Less than 1 EU/µg (determined by LAL method). For Research Use Only
Price
Catalog Number
$355
LS-G145709-50
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
HMG1 / HMGB1 Protein LS-G145709 is a Recombinant Human HMG1 / HMGB1 produced in E. coli with 6His, C-terminus tag(s). It is low in endotoxin; Less than 1 EU/µg (determined by LAL method). For Research Use Only

Specifications

Type
Recombinant Protein
Target
HMG1 / HMGB1
Synonyms
HMGB1 | Amphoterin | High mobility group protein B1 | High mobility group box 1 | High mobility group protein 1 | HMG1 | HMG3 | SBP-1 | High-mobility group box 1 | HMG-1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, C-terminus
Predicted Molecular Weight
26.0 kDa
AA Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by SDS-PAGE and HPLC
Usage Summary
A single non-glycosylated polypeptide chain containing 223 amino acids with 6 × His at C-terminus.
Bio-Activity
Not Tested
Endotoxin
Less than 1 EU/µg (determined by LAL method).
Presentation
Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4
Reconstitution
Briefly centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml.
Storage
Store lyophilized at 2°C to 8°C for short term storage. Store lyophilized at -20°C for long term storage. Store reconstituted at 2°C to 8°C for up to 1 week. Aliquot and store reconstituted at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About HMG1 / HMGB1
P09429 NM_002128 NP_002119.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/26/2024