Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human PPIL3 Protein (Recombinant His) - LS-G1449

Best Seller
Catalog
Size
Price
LS-G1449-100
100 µg (1 mg/ml)
$315
LS-G1449-0.5
0.5 mg (1 mg/ml)
$695
Description
PPIL3 Protein LS-G1449 is Recombinant Human PPIL3 in E. coli with His tag(s). It is biologically active
Type
Recombinant Protein
Target
PPIL3
Species
Human
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
Expression System
E. coli
Source Species
E. coli
Tag
His
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Specific activity is > 280 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 25C in Tris-Hcl pH8.0 using chymotrypsin.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 20% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About PPIL3
AA758661

Popular PPIL3 Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: His
Format: Purified / Biologically Active
Protein
Source: E. coli Expression System
Tag: His
Format: Purified / Biologically Active
12.5% SDS-PAGE of human PPIL3 stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified
Purified recombinant protein PPIL3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Requested From: United States
Date Requested: 9/15/2019