Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G1118-20 20 µg $261 
LS-G1118-100 100 µg (0.5 mg/ml) $361 
LS-G1118-500 500 µg $739 
TAF9 Protein

Human TAF9 Protein (Recombinant His) - LS-G1118

Human TAF9 Protein (Recombinant His) - LS-G1118

Description:
TAF9 Protein LS-G1118 is a Recombinant Human TAF9 produced in E. coli with His tag(s). For Research Use Only
Price
Catalog Number
$261
LS-G1118-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
TAF9 Protein LS-G1118 is a Recombinant Human TAF9 produced in E. coli with His tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TAF9
Synonyms
TAF9 | AD-004 | Adrenal gland protein AD-004 | ATP-AMP transphosphorylase 6 | CINAP | CGI-137 | Coilin interacting protein | TAFII-32 | TAFII32 | STAF31/32 | TAFII31 | CIP | TAF2G | TAFII-31 | TAFIID32
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
AA Sequence
MGSSHHHHHHSSGLVPRGSHMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 1 mM DTT, 10% Glycerol
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TAF9

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TAF9 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TAF9 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TAF9 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TAF9 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024