Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21503-20 20 µg $395 
LS-G21503-100 100 µg $565 
LS-G21503-1 1 mg $1,646 
Protein

Mycobacterium tuberculosis cyp125 Protein (Recombinant His-SUMO) (Full Length) - LS-G21503

Mycobacterium tuberculosis cyp125 Protein (Recombinant His-SUMO) (Full Length) - LS-G21503

Description:
cyp125 Protein LS-G21503 is a Recombinant Mycobacterium tuberculosis cyp125 produced in E. coli aa 1-433 with His-SUMO tag(s).
Price
Catalog Number
$395
LS-G21503-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
cyp125 Protein LS-G21503 is a Recombinant Mycobacterium tuberculosis cyp125 produced in E. coli aa 1-433 with His-SUMO tag(s).

Specifications

Type
Recombinant Protein
Target
cyp125
Synonyms
cyp125
Species
Mycobacterium tuberculosis
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 1-433
Predicted Molecular Weight
64.4 kD
AA Sequence
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About cyp125
NP_218062.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/15/2021