Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
Products
Antibodies
ELISA and Assay Kits
Research Areas
Infectious Disease
Resources
Purchasing
Reference Material
Contact Us
Locations
Orders Processing,
Shipping & Receiving,
Warehouse
2 Shaker Rd Suites
B001/B101
Shirley, MA 01464
Production Lab
Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036
Telephone Numbers
Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565
Contact Us
Additional Contact Details
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Forgot password?
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.
order histories, retained contact details for faster checkout, review submissions, and special promotions.
Quick Order
| Catalog Number | Size | Price |
|---|---|---|
| LS-G137137-20 | 20 µg | $364 |
| LS-G137137-100 | 100 µg | $500 |
| LS-G137137-1 | 1 mg | $1,679 |
1 of 3
2 of 3
3 of 3
Mouse UPK2 / UPII / Uroplakin 2 Protein (Recombinant GST-6His, N-terminus) (Full Length) - LS-G137137
Mouse UPK2 / UPII / Uroplakin 2 Protein (Recombinant GST-6His, N-terminus) (Full Length) - LS-G137137
Description:
UPK2 / UPII / Uroplakin 2 Protein LS-G137137 is a Recombinant Mouse UPK2 / UPII / Uroplakin 2 produced in E. coli 85-184aa with GST-6His, N-terminus tag(s). For Research Use Only
Toll Free North America
206-374-1102
206-374-1102For Research Use Only
Overview
Description:
UPK2 / UPII / Uroplakin 2 Protein LS-G137137 is a Recombinant Mouse UPK2 / UPII / Uroplakin 2 produced in E. coli 85-184aa with GST-6His, N-terminus tag(s). For Research Use Only
Specifications
Type
Recombinant Protein
Target
UPK2 / UPII / Uroplakin 2
Synonyms
UPK2 | UP2 | Uroplakin II | Uroplakin 2 | Uroplakin-2 | UPII
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST-6His, N-terminus
Region
85-184aa
Predicted Molecular Weight
40.8 kDa
AA Sequence
ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
About UPK2 / UPII / Uroplakin 2
Publications (0)
Customer Reviews (0)
Images
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Mass Cytometry
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Uroplakin-2(Upk2) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Request SDS/MSDS
To request an SDS/MSDS form for this product, please contact our Technical Support department at:
Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/27/2024
Date Requested: 4/27/2024
