Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > Serpina3n > LS-G136492
 
Print Page  
Catalog Number Size Price
LS-G136492-20 20 µg $364 
LS-G136492-100 100 µg $500 
LS-G136492-1 1 mg $1,679 
Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Serpina3n Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Serpina3n Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Mouse Serpina3n Protein (Recombinant 6His-SUMO, N-terminus) (Full Length) - LS-G136492

Mouse Serpina3n Protein (Recombinant 6His-SUMO, N-terminus) (Full Length) - LS-G136492

Submit Review LSBio Guarantee
Description:
Serpina3n Protein LS-G136492 is a Recombinant Mouse Serpina3n produced in E. coli 21-418aa with 6His-SUMO, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G136492-20
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Popular Serpina3n Proteins Request SDS/MSDS

Overview

Description:
Serpina3n Protein LS-G136492 is a Recombinant Mouse Serpina3n produced in E. coli 21-418aa with 6His-SUMO, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Serpina3n
Synonyms
Serpina3n
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
21-418aa
Predicted Molecular Weight
60.8kDa
AA Sequence
SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Serpina3n
Q91WP6

Publications (0)

Submit a Publication for LS-G136492

Customer Reviews (0)

Submit a review for LS-G136492

Images

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Serpina3n Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Serpina3n Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Serpina3n Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Mass Cytometry

Serpina3n Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Serine protease inhibitor A3N(Serpina3n) could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Serpina3n Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Popular Serpina3n Proteins

Serpina3n Protein
Mouse Serpina3n Protein (Recombinant His, N-Terminal) (aa21-418) - LS-G23437
Source: Yeast
Tag: His, N-Terminal

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/28/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com