Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > MCA32 > LS-G137359
 
Print Page  
Catalog Number Size Price
LS-G137359-20 20 µg $405 
LS-G137359-100 100 µg $598 
LS-G137359-1 1 mg $1,679 
MCA32 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
MCA32 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
1 of 3
2 of 3
3 of 3

Mouse MCA32 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G137359

Mouse MCA32 Protein (Recombinant 10His, N-terminus + Myc, C-terminus) - LS-G137359

Submit Review LSBio Guarantee
Description:
MCA32 Protein LS-G137359 is a Recombinant Mouse MCA32 produced in E. coli 34-150aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G137359-20
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Request SDS/MSDS

Overview

Description:
MCA32 Protein LS-G137359 is a Recombinant Mouse MCA32 produced in E. coli 34-150aa with 10His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
MCA32
Synonyms
MILR1 | Allergin-1 | ALLERGIN-1L | Allergy inhibitory receptor 1 | ALLERGIN-1S1 | C17orf60 | MCA32 | Mast cell antigen 32 | MCA-32
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus + Myc, C-terminus
Region
34-150aa
Predicted Molecular Weight
20.1 kDa
AA Sequence
ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About MCA32
Q7Z6M3 NM_001085423 NP_001078892.1

Publications (0)

Submit a Publication for LS-G137359

Customer Reviews (0)

Submit a review for LS-G137359

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MCA32 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MCA32 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MCA32 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MCA32 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Mass Cytometry

MCA32 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Allergin-1(Milr1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Milr1.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 5/2/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com