Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136397-20 20 µg $364 
LS-G136397-100 100 µg $500 
LS-G136397-1 1 mg $1,679 
CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
1 of 2
2 of 2

Mouse CTSL / Cathepsin L Protein (Recombinant 6His, N-terminus + Myc, C-terminus) - LS-G136397

Mouse CTSL / Cathepsin L Protein (Recombinant 6His, N-terminus + Myc, C-terminus) - LS-G136397

Description:
CTSL / Cathepsin L Protein LS-G136397 is a Recombinant Mouse CTSL / Cathepsin L produced in E. coli 114-288aa with 6His, N-terminus + Myc, C-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G136397-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CTSL / Cathepsin L Protein LS-G136397 is a Recombinant Mouse CTSL / Cathepsin L produced in E. coli 114-288aa with 6His, N-terminus + Myc, C-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
CTSL / Cathepsin L
Synonyms
CTSL | Cathepsin L | Cathepsin L1 | CATL | CTSL1 | Major excreted protein | MEP
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus + Myc, C-terminus
Region
114-288aa
Predicted Molecular Weight
26.2 kDa
AA Sequence
IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Important for the overall degradation of proteins in lysosomes.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CTSL / Cathepsin L
P07711 NM_001912 NP_001903.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Mass Cytometry

CTSL / Cathepsin L Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Cathepsin L1(Ctsl1),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/29/2024