Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G61398-10 10 µg $461 
LS-G61398-25 25 µg $611 
WASF2 / SCAR2 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human WASF2 / SCAR2 Protein (Recombinant GST, N-terminus) (aa73-172) - LS-G61398

Human WASF2 / SCAR2 Protein (Recombinant GST, N-terminus) (aa73-172) - LS-G61398

Available for shipment within the USA only
Description:
WASF2 / SCAR2 Protein LS-G61398 is a Recombinant Human WASF2 / SCAR2 produced in Wheat Germ Extract aa 73-172 with GST, N-terminus tag(s).
Price
Catalog Number
$461
LS-G61398-10

Available for USA Shipment Only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
WASF2 / SCAR2 Protein LS-G61398 is a Recombinant Human WASF2 / SCAR2 produced in Wheat Germ Extract aa 73-172 with GST, N-terminus tag(s).

Specifications

Type
Recombinant Protein
Target
WASF2 / SCAR2
Synonyms
WASF2 | DJ393P12.2 | IMD2 | Protein WAVE-2 | WASF4 | WAVE2 | SCAR2 | WASP family protein member 2 | WASP family protein member 4 | WAS protein family, member 2
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 73-172
AA Sequence
DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
Expression System
Wheat Germ Extract
Source Species
Wheat
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About WASF2 / SCAR2
Q9Y6W5 NM_006990 NP_008921.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

WASF2 / SCAR2 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

WASF2 / SCAR2 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

WASF2 / SCAR2 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

WASF2 / SCAR2 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/23/2021