Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G1691-50 50 µg (0.5 mg/ml) $401 
LS-G1691-250 250 µg (0.5 mg/ml) $925 
VEGFA / VEGF Protein
VEGFA / VEGF Protein
VEGFA / VEGF Protein
VEGFA / VEGF Protein
1 of 2
2 of 2

Human VEGFA / VEGF Protein (Recombinant) - LS-G1691

Human VEGFA / VEGF Protein (Recombinant) - LS-G1691

Description:
VEGFA / VEGF Protein LS-G1691 is a Recombinant Human VEGFA / VEGF produced in E. coli 207-371aa.
Price
Catalog Number
$401
LS-G1691-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
VEGFA / VEGF Protein LS-G1691 is a Recombinant Human VEGFA / VEGF produced in E. coli 207-371aa.

Specifications

Type
Recombinant Protein
Target
VEGFA / VEGF
Synonyms
VEGFA | VPF | Vascular permeability factor | VEGF | VEGF-A | MVCD1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Region
207-371aa
AA Sequence
MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Useful for SDS-PAGE applications
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl buffer (pH 8.5) containing 2mM EDTA, 0.1mM PMSF, 1mM DTT, 10% glycerol.
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About VEGFA / VEGF
P15692 NM_003376 NP_003367.4

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

VEGFA / VEGF Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021