Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G32646-10 10 µg $479 
LS-G32646-25 25 µg $670 
Vasohibin 1 / VASH1 Protein - 12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue

Human Vasohibin 1 / VASH1 Protein (Recombinant GST) (Full Length) - LS-G32646

Human Vasohibin 1 / VASH1 Protein (Recombinant GST) (Full Length) - LS-G32646

Available for shipment within the USA only
Description:
Vasohibin 1 / VASH1 Protein LS-G32646 is a Recombinant Human Vasohibin 1 / VASH1 produced in Wheat Germ Extract with GST tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G32646-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
Vasohibin 1 / VASH1 Protein LS-G32646 is a Recombinant Human Vasohibin 1 / VASH1 produced in Wheat Germ Extract with GST tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Vasohibin 1 / VASH1
Synonyms
VASH1 | KIAA1036 | VASH | Vasohibin 1 | Vasohibin-1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Predicted Molecular Weight
48.2 kDa
AA Sequence
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Expression System
Wheat Germ Extract
Source Species
Wheat
Purification
Glutathione Sepharose
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Vasohibin 1 / VASH1
Q7L8A9 NM_014909 NP_055724.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Vasohibin 1 / VASH1 Protein - 12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue
12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Vasohibin 1 / VASH1 Protein - 12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue
12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Vasohibin 1 / VASH1 Protein - 12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue
12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Vasohibin 1 / VASH1 Protein - 12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue
12.5% SDS-PAGE of human VASH1 stained with Coomassie Blue

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/14/2024