Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23178-20 20 µg $326 
LS-G23178-100 100 µg $436 
LS-G23178-500 500 µg $1,000 
TUBB2A / Tubulin Beta 2A Protein

Human TUBB2A / Tubulin Beta 2A Protein (Recombinant His) (Full Length) - LS-G23178

Human TUBB2A / Tubulin Beta 2A Protein (Recombinant His) (Full Length) - LS-G23178

Description:
TUBB2A / Tubulin Beta 2A Protein LS-G23178 is a Recombinant Human TUBB2A / Tubulin Beta 2A produced in Yeast aa 1-445 with His tag(s).
Price
Catalog Number
$326
LS-G23178-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
TUBB2A / Tubulin Beta 2A Protein LS-G23178 is a Recombinant Human TUBB2A / Tubulin Beta 2A produced in Yeast aa 1-445 with His tag(s).

Specifications

Type
Recombinant Protein
Target
TUBB2A / Tubulin Beta 2A
Synonyms
TUBB2A | Class IIa beta-tubulin | DJ40E16.7 | TUBB2 | Tubulin beta-2A chain | Tubulin, beta 2 | Tubulin, beta 2A | Tubulin, beta 2A class IIa | Beta-Tubulin | Tubulin beta-2 chain | Tubulin, beta polypeptide 2 | Tubulin, beta polypeptide
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 1-445
Predicted Molecular Weight
51.9 kD
AA Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Expression System
Yeast
Source Species
Yeast
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TUBB2A / Tubulin Beta 2A
Q13885 NM_001069 NP_001060.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TUBB2A / Tubulin Beta 2A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TUBB2A / Tubulin Beta 2A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TUBB2A / Tubulin Beta 2A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TUBB2A / Tubulin Beta 2A Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/18/2021