Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > TRA2B / SFRS10 > LS-G137112
 
Print Page  
Catalog Number Size Price
LS-G137112-20 20 µg $364 
LS-G137112-100 100 µg $500 
LS-G137112-1 1 mg $1,679 
TRA2B / SFRS10 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
TRA2B / SFRS10 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
1 of 3
2 of 3
3 of 3

Human TRA2B / SFRS10 Protein (Recombinant 6His-SUMO, N-terminus) - LS-G137112

Human TRA2B / SFRS10 Protein (Recombinant 6His-SUMO, N-terminus) - LS-G137112

Submit Review LSBio Guarantee
Description:
TRA2B / SFRS10 Protein LS-G137112 is a Recombinant Human TRA2B / SFRS10 produced in E. coli 111-201aa with 6His-SUMO, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$364
LS-G137112-20
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Request SDS/MSDS

Overview

Description:
TRA2B / SFRS10 Protein LS-G137112 is a Recombinant Human TRA2B / SFRS10 produced in E. coli 111-201aa with 6His-SUMO, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
TRA2B / SFRS10
Synonyms
TRA2B | Htra2-beta | SRFS10 | TRA2-BETA | TRAN2B | SFRS10 | TRA-2 beta
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
111-201aa
Predicted Molecular Weight
26.5 kDa
AA Sequence
RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the splicing of MAPT/Tau exon 10. Alters pre-mRNA splicing patterns by antagonizing the effects of splicing regulators, like RBMX. Binds to the AG-rich SE2 domain in the SMN exon 7 RNA. Binds to pre-mRNA.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TRA2B / SFRS10
P62995 NM_004593 NP_004584.1

Publications (0)

Submit a Publication for LS-G137112

Customer Reviews (0)

Submit a review for LS-G137112

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TRA2B / SFRS10 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TRA2B / SFRS10 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TRA2B / SFRS10 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

TRA2B / SFRS10 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Mass Cytometry

TRA2B / SFRS10 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Human Transformer-2 protein homolog beta(TRA2B),partial could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/28/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com