Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G89338-20 20 µg $125 
TNFSF15 / TL1A / VEGI Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Human TNFSF15 / TL1A / VEGI Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G89338

Human TNFSF15 / TL1A / VEGI Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G89338

Description:
TNFSF15 / TL1A / VEGI Protein LS-G89338 is an Over-Expression Lysate Human TNFSF15 / TL1A / VEGI with Myc-DDK (Flag) tag(s).
Price
Catalog Number
$125
LS-G89338-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
TNFSF15 / TL1A / VEGI Protein LS-G89338 is an Over-Expression Lysate Human TNFSF15 / TL1A / VEGI with Myc-DDK (Flag) tag(s).

Specifications

Type
Over-Expression Lysate Protein
Target
TNFSF15 / TL1A / VEGI
Synonyms
TNFSF15 | TL1 | TL1A | TNF ligand-related molecule 1 | TNF superfamily ligand TL1A | VEGI192A | VEGI
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
27.9 kDa
AA Sequence
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL(CloningSiteandTags:myc-FLAG tag)
Expression System
293T Cells
Source Species
Human
Purification
Unpurified
Usage Summary
Western blot: Spin down briefly and resuspend in 2X SDS Sample Buffer (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 minutes.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized. 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA3VO4
Reconstitution
Reconstitute with SDS Sample Buffer
Storage
Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About TNFSF15 / TL1A / VEGI
O95150 NM_005118 NP_005109.2

Publications (0)

Customer Reviews (0)

Images

Western blot

TNFSF15 / TL1A / VEGI Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

TNFSF15 / TL1A / VEGI Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

TNFSF15 / TL1A / VEGI Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

TNFSF15 / TL1A / VEGI Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/16/2021